PDB entry 5eu9

View 5eu9 on RCSB PDB site
Description: Structure of Human Enolase 2 in complex with ((3S,5S)-1,5-dihydroxy-3-methyl-2-oxopyrrolidin-3-yl)phosphonic acid
Class: lyase/lyase inhibitor
Keywords: enolase gamma, glycolysis, neuron specific enolase, carbohydrate metabolism, LYASE-LYASE INHIBITOR complex
Deposited on 2015-11-18, released 2016-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma-enolase
    Species: Homo sapiens [TaxId:9606]
    Gene: ENO2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5eu9a1, d5eu9a2
  • Chain 'B':
    Compound: Gamma-enolase
    Species: Homo sapiens [TaxId:9606]
    Gene: ENO2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5eu9b1, d5eu9b2
  • Chain 'C':
    Compound: Gamma-enolase
    Species: Homo sapiens [TaxId:9606]
    Gene: ENO2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09104 (Start-433)
      • expression tag (434-436)
    Domains in SCOPe 2.07: d5eu9c1, d5eu9c2, d5eu9c3
  • Chain 'D':
    Compound: Gamma-enolase
    Species: Homo sapiens [TaxId:9606]
    Gene: ENO2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5eu9d1, d5eu9d2
  • Chain 'E':
    Compound: Gamma-enolase
    Species: Homo sapiens [TaxId:9606]
    Gene: ENO2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5eu9e1, d5eu9e2
  • Chain 'F':
    Compound: Gamma-enolase
    Species: Homo sapiens [TaxId:9606]
    Gene: ENO2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09104 (Start-433)
      • expression tag (434)
    Domains in SCOPe 2.07: d5eu9f1, d5eu9f2, d5eu9f3
  • Chain 'G':
    Compound: Gamma-enolase
    Species: Homo sapiens [TaxId:9606]
    Gene: ENO2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5eu9g1, d5eu9g2
  • Chain 'H':
    Compound: Gamma-enolase
    Species: Homo sapiens [TaxId:9606]
    Gene: ENO2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5eu9h1, d5eu9h2
  • Heterogens: MG, 5TX, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5eu9A (A:)
    msiekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgk
    gvlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavck
    agaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrd
    amrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagyteki
    vigmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqdd
    waawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqackla
    qengwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgde
    arfaghnfrnpsvlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5eu9A (A:)
    siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
    vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
    gaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrda
    mrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagytekiv
    igmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddw
    aawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqacklaq
    engwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgdea
    rfaghnfrnpsvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5eu9B (B:)
    msiekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgk
    gvlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavck
    agaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrd
    amrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagyteki
    vigmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqdd
    waawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqackla
    qengwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgde
    arfaghnfrnpsvlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5eu9B (B:)
    siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
    vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
    gaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrda
    mrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagytekiv
    igmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddw
    aawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqacklaq
    engwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgdea
    rfaghnfrnpsvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5eu9C (C:)
    msiekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgk
    gvlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavck
    agaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrd
    amrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagyteki
    vigmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqdd
    waawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqackla
    qengwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgde
    arfaghnfrnpsvlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5eu9C (C:)
    siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
    vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
    gaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrda
    mrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagytekiv
    igmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddw
    aawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqacklaq
    engwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgdea
    rfaghnfrnpsvlhhh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5eu9D (D:)
    msiekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgk
    gvlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavck
    agaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrd
    amrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagyteki
    vigmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqdd
    waawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqackla
    qengwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgde
    arfaghnfrnpsvlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5eu9D (D:)
    siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
    vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
    gaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrda
    mrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagytekiv
    igmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddw
    aawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqacklaq
    engwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgdea
    rfaghnfrnpsvl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5eu9E (E:)
    msiekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgk
    gvlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavck
    agaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrd
    amrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagyteki
    vigmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqdd
    waawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqackla
    qengwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgde
    arfaghnfrnpsvlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5eu9E (E:)
    siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
    vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
    gaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrda
    mrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagytekiv
    igmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddw
    aawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqacklaq
    engwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgdea
    rfaghnfrnpsvl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5eu9F (F:)
    msiekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgk
    gvlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavck
    agaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrd
    amrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagyteki
    vigmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqdd
    waawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqackla
    qengwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgde
    arfaghnfrnpsvlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5eu9F (F:)
    siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
    vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
    gaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrda
    mrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagytekiv
    igmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddw
    aawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqacklaq
    engwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgdea
    rfaghnfrnpsvlh
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5eu9G (G:)
    msiekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgk
    gvlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavck
    agaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrd
    amrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagyteki
    vigmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqdd
    waawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqackla
    qengwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgde
    arfaghnfrnpsvlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5eu9G (G:)
    siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
    vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
    gaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrda
    mrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagytekiv
    igmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddw
    aawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqacklaq
    engwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgdea
    rfaghnfrnpsvl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5eu9H (H:)
    msiekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgk
    gvlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavck
    agaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrd
    amrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagyteki
    vigmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqdd
    waawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqackla
    qengwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgde
    arfaghnfrnpsvlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5eu9H (H:)
    siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
    vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
    gaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrda
    mrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagytekiv
    igmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddw
    aawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqacklaq
    engwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgdea
    rfaghnfrnpsvl