PDB entry 5etc

View 5etc on RCSB PDB site
Description: Structure of inactive MAPK14 with ordered Activation Loop
Class: transferase
Keywords: MAPK14, inactive kinase, activation loop, MAPK, transferase
Deposited on 2015-11-17, released 2016-01-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-01-20, with a file datestamp of 2016-01-15.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2, SAPK2A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16539 (3-End)
      • initiating methionine (0)
      • expression tag (1-2)
    Domains in SCOPe 2.06: d5etca_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5etcA (A:)
    mlemsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsr
    pfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnniv
    kcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtdd
    emtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilr
    lvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkri
    taaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqee
    mes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5etcA (A:)
    mlemsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsr
    pfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnniv
    kcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtdd
    emtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilr
    lvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkri
    taaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvppp