PDB entry 5esb

View 5esb on RCSB PDB site
Description: Crystal structure of a genotype 1a/3a chimeric HCV NS3/4A protease in complex with Vaniprevir
Class: hYDROLASE/hYDROLASE iNHIBITOR
Keywords: Vaniprevir, drug resistance, HCV protease inhibitor, Genotype 3, HYDROLASE, hYDROLASE-hYDROLASE iNHIBITOR complex
Deposited on 2015-11-16, released 2016-11-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NS3 protease
    Species: Hepatitis C virus [TaxId:11103]
    Database cross-references and differences (RAF-indexed):
    • Uniprot C1KIK8 (17-192)
      • expression tag (0-16)
      • conflict (26-27)
      • conflict (30-31)
      • conflict (34)
      • conflict (53)
      • conflict (60)
      • conflict (65)
      • conflict (85)
      • conflict (99)
      • engineered mutation (136)
      • engineered mutation (145)
      • conflict (172)
      • engineered mutation (181)
    Domains in SCOPe 2.08: d5esba1, d5esba2
  • Heterogens: ZN, SO4, SU3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5esbA (A:)
    kkkgsvvivgrinlsgdtayaqqtrgeegcqetsqtgrdknqvegevqivstatqtflat
    singvlwtvyhgagtrtiaspkgpvtqmytnvdkdlvgwqapqgsrsltpctcgssdlyl
    vtrhadvipvrrrgdstgsllsprplsylkgssggpllcpaghavgifraavstrgvaka
    vqfipveslettm