PDB entry 5es3

View 5es3 on RCSB PDB site
Description: Co-crystal structure of LDH liganded with oxamate
Class: oxidoreductase
Keywords: Lactate dehydrogenase, allostery, OXIDOREDUCTASE
Deposited on 2015-11-16, released 2016-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-13, with a file datestamp of 2016-01-08.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-lactate dehydrogenase A chain
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Ldha, Ldh-1, Ldh1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5es3a1, d5es3a2
  • Chain 'B':
    Compound: L-lactate dehydrogenase A chain
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Ldha, Ldh-1, Ldh1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5es3b1, d5es3b2
  • Chain 'C':
    Compound: L-lactate dehydrogenase A chain
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Ldha, Ldh-1, Ldh1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5es3c1, d5es3c2
  • Chain 'D':
    Compound: L-lactate dehydrogenase A chain
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Ldha, Ldh-1, Ldh1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5es3d1, d5es3d2
  • Chain 'E':
    Compound: L-lactate dehydrogenase A chain
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Ldha, Ldh-1, Ldh1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5es3e1, d5es3e2
  • Chain 'F':
    Compound: L-lactate dehydrogenase A chain
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Ldha, Ldh-1, Ldh1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5es3f1, d5es3f2
  • Chain 'G':
    Compound: L-lactate dehydrogenase A chain
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Ldha, Ldh-1, Ldh1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5es3g1, d5es3g2
  • Chain 'H':
    Compound: L-lactate dehydrogenase A chain
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Ldha, Ldh-1, Ldh1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5es3h1, d5es3h2
  • Heterogens: OXM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5es3A (A:)
    aalkdqlivnllkeeqvpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspqckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgvnvagvslkslnpqlgtdadkeqwkdvhkqvvdsayev
    iklkgytswaiglsvadlaesimknlrrvhpistmikglygikedvflsvpcilgqngis
    dvvkvtltpdeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5es3A (A:)
    kdqlivnllkeeqvpqnkitvvgvgavgmacaisilmkdladelalvdviedklkgemmd
    lqhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfiipnv
    vkyspqckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvhpls
    chgwvlgehgdssvpvwsgvnvagvslkslnpqlgtdadkeqwkdvhkqvvdsayevikl
    kgytswaiglsvadlaesimknlrrvhpistmikglygikedvflsvpcilgqngisdvv
    kvtltpdeearlkksadtlwgiqkelqf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5es3B (B:)
    aalkdqlivnllkeeqvpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspqckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgvnvagvslkslnpqlgtdadkeqwkdvhkqvvdsayev
    iklkgytswaiglsvadlaesimknlrrvhpistmikglygikedvflsvpcilgqngis
    dvvkvtltpdeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5es3B (B:)
    dqlivnllkeeqvpqnkitvvgvgavgmacaisilmkdladelalvdviedklkgemmdl
    qhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfiipnvv
    kyspqckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvhplsc
    hgwvlgehgdssvpvwsgvnvagvslkslnpqlgtdadkeqwkdvhkqvvdsayeviklk
    gytswaiglsvadlaesimknlrrvhpistmikglygikedvflsvpcilgqngisdvvk
    vtltpdeearlkksadtlwgiqkelqf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5es3C (C:)
    aalkdqlivnllkeeqvpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspqckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgvnvagvslkslnpqlgtdadkeqwkdvhkqvvdsayev
    iklkgytswaiglsvadlaesimknlrrvhpistmikglygikedvflsvpcilgqngis
    dvvkvtltpdeearlkksadtlwgiqkelqf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5es3D (D:)
    aalkdqlivnllkeeqvpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspqckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgvnvagvslkslnpqlgtdadkeqwkdvhkqvvdsayev
    iklkgytswaiglsvadlaesimknlrrvhpistmikglygikedvflsvpcilgqngis
    dvvkvtltpdeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5es3D (D:)
    dqlivnllkeeqvpqnkitvvgvgavgmacaisilmkdladelalvdviedklkgemmdl
    qhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfiipnvv
    kyspqckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvhplsc
    hgwvlgehgdssvpvwsgvnvagvslkslnpqlgtdadkeqwkdvhkqvvdsayeviklk
    gytswaiglsvadlaesimknlrrvhpistmikglygikedvflsvpcilgqngisdvvk
    vtltpdeearlkksadtlwgiqkelqf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5es3E (E:)
    aalkdqlivnllkeeqvpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspqckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgvnvagvslkslnpqlgtdadkeqwkdvhkqvvdsayev
    iklkgytswaiglsvadlaesimknlrrvhpistmikglygikedvflsvpcilgqngis
    dvvkvtltpdeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5es3E (E:)
    alkdqlivnllkeeqvpqnkitvvgvgavgmacaisilmkdladelalvdviedklkgem
    mdlqhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfiip
    nvvkyspqckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvhp
    lschgwvlgehgdssvpvwsgvnvagvslkslnpqlgtdadkeqwkdvhkqvvdsayevi
    klkgytswaiglsvadlaesimknlrrvhpistmikglygikedvflsvpcilgqngisd
    vvkvtltpdeearlkksadtlwgiqkelqf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5es3F (F:)
    aalkdqlivnllkeeqvpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspqckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgvnvagvslkslnpqlgtdadkeqwkdvhkqvvdsayev
    iklkgytswaiglsvadlaesimknlrrvhpistmikglygikedvflsvpcilgqngis
    dvvkvtltpdeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5es3F (F:)
    dqlivnllkeeqvpqnkitvvgvgavgmacaisilmkdladelalvdviedklkgemmdl
    qhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfiipnvv
    kyspqckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvhplsc
    hgwvlgehgdssvpvwsgvnvagvslkslnpqlgtdadkeqwkdvhkqvvdsayeviklk
    gytswaiglsvadlaesimknlrrvhpistmikglygikedvflsvpcilgqngisdvvk
    vtltpdeearlkksadtlwgiqkelqf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5es3G (G:)
    aalkdqlivnllkeeqvpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspqckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgvnvagvslkslnpqlgtdadkeqwkdvhkqvvdsayev
    iklkgytswaiglsvadlaesimknlrrvhpistmikglygikedvflsvpcilgqngis
    dvvkvtltpdeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5es3G (G:)
    kdqlivnllkeeqvpqnkitvvgvgavgmacaisilmkdladelalvdviedklkgemmd
    lqhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfiipnv
    vkyspqckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvhpls
    chgwvlgehgdssvpvwsgvnvagvslkslnpqlgtdadkeqwkdvhkqvvdsayevikl
    kgytswaiglsvadlaesimknlrrvhpistmikglygikedvflsvpcilgqngisdvv
    kvtltpdeearlkksadtlwgiqkelqf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5es3H (H:)
    aalkdqlivnllkeeqvpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspqckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgvnvagvslkslnpqlgtdadkeqwkdvhkqvvdsayev
    iklkgytswaiglsvadlaesimknlrrvhpistmikglygikedvflsvpcilgqngis
    dvvkvtltpdeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5es3H (H:)
    dqlivnllkeeqvpqnkitvvgvgavgmacaisilmkdladelalvdviedklkgemmdl
    qhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfiipnvv
    kyspqckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvhplsc
    hgwvlgehgdssvpvwsgvnvagvslkslnpqlgtdadkeqwkdvhkqvvdsayeviklk
    gytswaiglsvadlaesimknlrrvhpistmikglygikedvflsvpcilgqngisdvvk
    vtltpdeearlkksadtlwgiqkelqf