PDB entry 5err

View 5err on RCSB PDB site
Description: GephE in complex with Mg(2+) - ADP
Class: transferase
Keywords: molybdenum and tungsten cofactor, Moco, Wco, terminal step, transferase
Deposited on 2015-11-15, released 2016-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-05-11, with a file datestamp of 2016-05-06.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gephyrin
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gphn, Gph
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5erra1, d5erra2, d5erra3
  • Heterogens: ADP, MG, ACT, MPD, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5errA (A:)
    mspfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdgya
    vraadgpgdrfiigesqageqptqtvmpgqvmrvttgapipcgadavvqvedteliresd
    dgteelevrilvqarpgqdirpighdikrgecvlakgthmgpseigllatvgvtevevnk
    fpvvavmstgnellnpeddllpgkirdsnrstllatiqehgyptinlgivgdnpddllna
    lnegisradviitsggvsmgekdylkqvldidlhaqihfgrvfmkpglpttfatldidgv
    rkiifalpgnpvsavvtcnlfvvpalrkmqgildprptiikarlscdvkldprpeyhrci
    ltwhhqeplpwaqstgnqmssrlmsmrsangllmlppkteqyvelhkgevvdvmvigrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5errA (A:)
    spfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdgyav
    raadgpgdrfiigesqageqptqtvmpgqvmrvttgapipcgadavvqvedteliresdd
    gteelevrilvqarpgqdirpighdikrgecvlakgthmgpseigllatvgvtevevnkf
    pvvavmstgnellnpeddllpgkirdsnrstllatiqehgyptinlgivgdnpddllnal
    negisradviitsggvsmgekdylkqvldidlhaqihfgrvfmkpglpttfatldidgvr
    kiifalpgnpvsavvtcnlfvvpalrkmqgildprptiikarlscdvkldprpeyhrcil
    twhhqeplpwaqstgsrlmsmrsangllmlppkteqyvelhkgevvdvmvigrl