PDB entry 5er5

View 5er5 on RCSB PDB site
Description: Crystal Structure of Calcium-loaded S100B bound to SC1990
Class: metal binding protein/inhibitor
Keywords: malignant melanoma, calcium binding, complex, covalent inhibitor, METAL BINDING PROTEIN-INHIBITOR complex
Deposited on 2015-11-13, released 2016-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 1.26 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein S100-B
  Species: Bos taurus [TaxId:9913]
  Gene: S100B
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02638 (0-End)
  Domains in SCOPe 2.08: d5er5a_
• Heterogens: CA, ET, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >5er5A (A:)
  mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
  ldsdgdgecdfqefmafvamittacheffehe
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >5er5A (A:)
  mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
  ldsdgdgecdfqefmafvamittacheffe