PDB entry 5er2

View 5er2 on RCSB PDB site
Description: High-resolution X-ray diffraction study of the complex between endothiapepsin and an oligopeptide inhibitor. the analysis of the inhibitor binding and description of the rigid body shift in the enzyme
Class: hydrolase/hydrolase inhibitor
Keywords: ACID PROTEINASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 1991-01-02, released 1991-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: endothiapepsin
    Species: CRYPHONECTRIA PARASITICA [TaxId:5116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5er2e_
  • Heterogens: 0EK, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5er2E (E:)
    stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
    psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
    tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
    gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
    gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
    ginifgdvalkaafvvfngattptlgfask