PDB entry 5eqq

View 5eqq on RCSB PDB site
Description: Crystal structure of HCV NS3/4A WT protease in complex with 5172-Linear (MK-5172 linear analogue)
Class: Hydrolase/Hydrolase Inhibitor
Keywords: macrocyclization, MK-5172 analogue, grazoprevir, HCV protease inhibitor resistance, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2015-11-13, released 2016-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: NS3 protease
  Species: Hepatitis C virus [TaxId:11103]
  Database cross-references and differences (RAF-indexed):
  • Uniprot C1KIK8 (14-189)
    • expression tag (0-13)
    • conflict (23-24)
    • conflict (27-28)
    • conflict (31)
    • conflict (50)
    • conflict (57)
    • conflict (62)
    • conflict (82)
    • conflict (96)
    • conflict (149)
  Domains in SCOPe 2.08: d5eqqa1, d5eqqa2
• Heterogens: SO4, ZN, 5RS, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5eqqA (A:)
  gsvvivgrinlsgdtayaqqtrgeegcqetsqtgrdknqvegevqivstatqtflatsin
  gvlwtvyhgagtrtiaspkgpvtqmytnvdkdlvgwqapqgsrsltpctcgssdlylvtr
  hadvipvrrrgdsrgsllsprpisylkgsaggpllcpaghavgifraavctrgvakavdf
  ipveslettm