PDB entry 5eqc

View 5eqc on RCSB PDB site
Description: Structure of the ornithine aminotransferase from Toxoplasma gondii crystallized in presence of oxidized glutathione reveals partial occupancy of PLP at the protein active site
Class: transferase
Keywords: PLP, gabaculine, parasite, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, TRANSFERASE
Deposited on 2015-11-12, released 2016-02-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-02-24, with a file datestamp of 2016-02-19.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ornithine aminotransferase, mitochondrial
    Species: Toxoplasma gondii [TaxId:5811]
    Gene: TGME49_269110
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5eqca_
  • Chain 'B':
    Compound: Ornithine aminotransferase, mitochondrial
    Species: Toxoplasma gondii [TaxId:5811]
    Gene: TGME49_269110
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5eqcb_
  • Heterogens: GLC, BGC, TRS, PEG, PLP, BTB, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5eqcA (A:)
    matksdgsasaaaeggarktnieayrdglklkteedffacdrqyvcqnyapvpvviskgk
    garvwdingneyydflagvsslsqghchprviaalcrqaerltltlrafgndvtgpacrf
    maemfgydrvllmntgaeagesalkiarkwayevkeippdsakvilcnnnywgrtitacs
    ssttfdcynnfgpftpgfelidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgyl
    krahelcrsknvllivdeiqtglcrtgrllaadhdevhpdilllgkslsagvvpisavmg
    radvmdvlkpgthgstfggnplacavavealtvlkdekladraerlgaqfrdclrrelyg
    kvpwikeirgrgllnavevdsdaidpndvvmklkengilskptrgrvmrfipplvitdee
    hrdattriiksflaveeerkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5eqcA (A:)
    garktnieayrdglklkteedffacdrqyvcqnyapvpvviskgkgarvwdingneyydf
    lagvsslsqghchprviaalcrqaerltltlrafgndvtgpacrfmaemfgydrvllmnt
    gaeagesalkiarkwayevkeippdsakvilcnnnywgrtitacsssttfdcynnfgpft
    pgfelidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgylkrahelcrsknvlli
    vdeiqtglcrtgrllaadhdevhpdilllgkslsagvvpisavmgradvmdvlkpgthgs
    tfggnplacavavealtvlkdekladraerlgaqfrdclrrelygkvpwikeirgrglln
    avevdsdaidpndvvmklkengilskptrgrvmrfipplvitdeehrdattriiksflav
    eeerkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5eqcB (B:)
    matksdgsasaaaeggarktnieayrdglklkteedffacdrqyvcqnyapvpvviskgk
    garvwdingneyydflagvsslsqghchprviaalcrqaerltltlrafgndvtgpacrf
    maemfgydrvllmntgaeagesalkiarkwayevkeippdsakvilcnnnywgrtitacs
    ssttfdcynnfgpftpgfelidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgyl
    krahelcrsknvllivdeiqtglcrtgrllaadhdevhpdilllgkslsagvvpisavmg
    radvmdvlkpgthgstfggnplacavavealtvlkdekladraerlgaqfrdclrrelyg
    kvpwikeirgrgllnavevdsdaidpndvvmklkengilskptrgrvmrfipplvitdee
    hrdattriiksflaveeerkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5eqcB (B:)
    rktnieayrdglklkteedffacdrqyvcqnyapvviskgkgarvwdingneyydflagv
    sslsqghchprviaalcrqaerltltlrafgndvtgpacrfmaemfgydrvllmntgaea
    gesalkiarkwayevkeippdsakvilcnnnywgrtitacsssttfdcynnfgpftpgfe
    lidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgylkrahelcrsknvllivdei
    qtglcrtgrllaadhdevhpdilllgkslsagvvpisavmgradvmdvlkpgthgstfgg
    nplacavavealtvlkdekladraerlgaqfrdclrrelygkvpwikeirgrgllnavev
    dsdaidpndvvmklkengilskptrgrvmrfipplvitdeehrdattriiksflaveeer
    kk