SCOPe 2.06: Structural Classification of Proteins

PDB entry 5epu

View 5epu on RCSB PDB site
Description: X-ray structure uridine phosphorylase from Vibrio cholerae in complex with cytosine at 1.06A.
Class: transferase
Keywords: TRANSFERASE, Rossmann Fold
Deposited on 2015-11-12, released 2016-11-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-11-23, with a file datestamp of 2016-11-18.
Experiment type: XRAY
Resolution: 1.06 Å
R-factor: N/A
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Uridine phosphorylase
Species: Vibrio cholerae [TaxId:666]
Gene: udp, udp_1, udp_2, DN30_1909, EN12_05055, ERS013138_02408, ERS013140_00580, ERS013160_01327, ERS013186_00327, ERS013199_00063, ERS013201_00032, ERS013202_00369, ERS013206_00377, ERS013212_00480
Database cross-references and differences (RAF-indexed):
- Uniprot Q9K4U1 (Start-252)
Domains in SCOPe 2.06: d5epua_
Chain 'B':
Compound: Uridine phosphorylase
Species: Vibrio cholerae [TaxId:666]
Gene: udp, udp_1, udp_2, DN30_1909, EN12_05055, ERS013138_02408, ERS013140_00580, ERS013160_01327, ERS013186_00327, ERS013199_00063, ERS013201_00032, ERS013202_00369, ERS013206_00377, ERS013212_00480
Database cross-references and differences (RAF-indexed):
- Uniprot Q9K4U1 (Start-252)
Domains in SCOPe 2.06: d5epub_
Chain 'C':
Compound: Uridine phosphorylase
Species: Vibrio cholerae [TaxId:666]
Gene: udp, udp_1, udp_2, DN30_1909, EN12_05055, ERS013138_02408, ERS013140_00580, ERS013160_01327, ERS013186_00327, ERS013199_00063, ERS013201_00032, ERS013202_00369, ERS013206_00377, ERS013212_00480
Database cross-references and differences (RAF-indexed):
- Uniprot Q9K4U1 (Start-252)
Domains in SCOPe 2.06: d5epuc_
Chain 'D':
Compound: Uridine phosphorylase
Species: Vibrio cholerae [TaxId:666]
Gene: udp, udp_1, udp_2, DN30_1909, EN12_05055, ERS013138_02408, ERS013140_00580, ERS013160_01327, ERS013186_00327, ERS013199_00063, ERS013201_00032, ERS013202_00369, ERS013206_00377, ERS013212_00480
Database cross-references and differences (RAF-indexed):
- Uniprot Q9K4U1 (Start-252)
Domains in SCOPe 2.06: d5epud_
Chain 'E':
Compound: Uridine phosphorylase
Species: Vibrio cholerae [TaxId:666]
Gene: udp, udp_1, udp_2, DN30_1909, EN12_05055, ERS013138_02408, ERS013140_00580, ERS013160_01327, ERS013186_00327, ERS013199_00063, ERS013201_00032, ERS013202_00369, ERS013206_00377, ERS013212_00480
Database cross-references and differences (RAF-indexed):
- Uniprot Q9K4U1 (Start-252)
Domains in SCOPe 2.06: d5epue_
Chain 'F':
Compound: Uridine phosphorylase
Species: Vibrio cholerae [TaxId:666]
Gene: udp, udp_1, udp_2, DN30_1909, EN12_05055, ERS013138_02408, ERS013140_00580, ERS013160_01327, ERS013186_00327, ERS013199_00063, ERS013201_00032, ERS013202_00369, ERS013206_00377, ERS013212_00480
Database cross-references and differences (RAF-indexed):
- Uniprot Q9K4U1 (Start-252)
Domains in SCOPe 2.06: d5epuf_
Heterogens: CYT, GOL, MG, NA, CL, TRS, EDO, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>5epuA (A:)
mtktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqs
vvvcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgasl
hfapmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfq
gsmkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketears
ikvvveaarkmlk