PDB entry 5epo

View 5epo on RCSB PDB site
Description: The three-dimensional structure of Clostridium absonum 7alpha-hydroxysteroid dehydrogenase
Class: oxidoreductase
Keywords: Oxidoreductase Activity, Metabolic Process, OXIDOREDUCTASE
Deposited on 2015-11-12, released 2016-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 7-alpha-hydroxysteroid deydrogenase
    Species: CLOSTRIDIUM SARDINIENSE [TaxId:29369]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5epoa_
  • Chain 'B':
    Compound: 7-alpha-hydroxysteroid deydrogenase
    Species: CLOSTRIDIUM SARDINIENSE [TaxId:29369]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5epob_
  • Chain 'C':
    Compound: 7-alpha-hydroxysteroid deydrogenase
    Species: CLOSTRIDIUM SARDINIENSE [TaxId:29369]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5epoc_
  • Chain 'D':
    Compound: 7-alpha-hydroxysteroid deydrogenase
    Species: CLOSTRIDIUM SARDINIENSE [TaxId:29369]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5epod_
  • Heterogens: NAP, TUD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5epoA (A:)
    mkrlegkvaivtsstrgigrasaealakegalvylaarseelaneviadikkqggvakfv
    yfnareeetytsmvekvaeaegridilvnnyggtnvnldknltagdtdeffrilkdnvqs
    vylpakaaiphmekvgggsivnistigsvvpdisriaycvsksainsltqnialqyarkn
    ircnavlpgligtraalenmtdefrdsflghvplnrvgrpedianavlyyasddsgyvtg
    mihevaggfalgtpqyseycpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5epoA (A:)
    krlegkvaivtsstrgigrasaealakegalvylaarseelaneviadikkqggvakfvy
    fnareeetytsmvekvaeaegridilvnnyggtnvnldknltagdtdeffrilkdnvqsv
    ylpakaaiphmekvgggsivnistigsvvpdisriaycvsksainsltqnialqyarkni
    rcnavlpgligtraalenmtdefrdsflghvplnrvgrpedianavlyyasddsgyvtgm
    ihevaggfalgtpqyseycpr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5epoB (B:)
    mkrlegkvaivtsstrgigrasaealakegalvylaarseelaneviadikkqggvakfv
    yfnareeetytsmvekvaeaegridilvnnyggtnvnldknltagdtdeffrilkdnvqs
    vylpakaaiphmekvgggsivnistigsvvpdisriaycvsksainsltqnialqyarkn
    ircnavlpgligtraalenmtdefrdsflghvplnrvgrpedianavlyyasddsgyvtg
    mihevaggfalgtpqyseycpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5epoB (B:)
    krlegkvaivtsstrgigrasaealakegalvylaarseelaneviadikkqggvakfvy
    fnareeetytsmvekvaeaegridilvnnyggtnvnldknltagdtdeffrilkdnvqsv
    ylpakaaiphmekvgggsivnistigsvvpdisriaycvsksainsltqnialqyarkni
    rcnavlpgligtraalenmtdefrdsflghvplnrvgrpedianavlyyasddsgyvtgm
    ihevaggfalgtpqyseycpr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5epoC (C:)
    mkrlegkvaivtsstrgigrasaealakegalvylaarseelaneviadikkqggvakfv
    yfnareeetytsmvekvaeaegridilvnnyggtnvnldknltagdtdeffrilkdnvqs
    vylpakaaiphmekvgggsivnistigsvvpdisriaycvsksainsltqnialqyarkn
    ircnavlpgligtraalenmtdefrdsflghvplnrvgrpedianavlyyasddsgyvtg
    mihevaggfalgtpqyseycpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5epoC (C:)
    krlegkvaivtsstrgigrasaealakegalvylaarseelaneviadikkqggvakfvy
    fnareeetytsmvekvaeaegridilvnnyggtnvnldknltagdtdeffrilkdnvqsv
    ylpakaaiphmekvgggsivnistigsvvpdisriaycvsksainsltqnialqyarkni
    rcnavlpgligtraalenmtdefrdsflghvplnrvgrpedianavlyyasddsgyvtgm
    ihevaggfalgtpqyseycpr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5epoD (D:)
    mkrlegkvaivtsstrgigrasaealakegalvylaarseelaneviadikkqggvakfv
    yfnareeetytsmvekvaeaegridilvnnyggtnvnldknltagdtdeffrilkdnvqs
    vylpakaaiphmekvgggsivnistigsvvpdisriaycvsksainsltqnialqyarkn
    ircnavlpgligtraalenmtdefrdsflghvplnrvgrpedianavlyyasddsgyvtg
    mihevaggfalgtpqyseycpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5epoD (D:)
    mkrlegkvaivtsstrgigrasaealakegalvylaarseelaneviadikkqggvakfv
    yfnareeetytsmvekvaeaegridilvnnyggtnvnldknltagdtdeffrilkdnvqs
    vylpakaaiphmekvgggsivnistigsvvpdisriaycvsksainsltqnialqyarkn
    ircnavlpgligtraalenmtdefrdsflghvplnrvgrpedianavlyyasddsgyvtg
    mihevaggfalgtpqyseycp