PDB entry 5eob

View 5eob on RCSB PDB site
Description: Crystal structure of CMET in complex with novel inhibitor
Class: transferase
Keywords: CMET inhibitor, TRANSFERASE
Deposited on 2015-11-10, released 2016-10-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-10-19, with a file datestamp of 2016-10-14.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5eoba_
  • Heterogens: 5QQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5eobA (A:)
    mgsshhhhhhgdsdisspllqntvhidlsalnpelvqavqhvvigpsslivhfnevigrg
    hfgcvyhgtlldndgkkihcavkslnritdigevsqfltegiimkdfshpnvlsllgicl
    rsegsplvvlpymkhgdlrnfirnethnptvkdligfglqvakgmkylaskkfvhrdlaa
    rncmldekftvkvadfglardmydkeyysvhnktgaklpvkwmaleslqtqkfttksdvw
    sfgvllwelmtrgappypdvntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemr
    psfselvsrisaifstfig
    

    Sequence, based on observed residues (ATOM records): (download)
    >5eobA (A:)
    lsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavkslnr
    itdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirneth
    nptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmydkey
    ysvtgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyll
    qgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfi