PDB entry 5eni

View 5eni on RCSB PDB site
Description: Crystal structure of the second bromodomain of Pleckstrin homology domain interacting protein (PHIP) in complex with compound-13 N11537 (SGC - Diamond I04-1 fragment screening)
Class: signaling protein
Keywords: bromodomain, PHIP, crystallographic fragment screen, Structural Genomics, Structural Genomics Consortium, SGC, transcription, signaling protein
Deposited on 2015-11-09, released 2016-04-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PH-interacting protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PHIP, WDR11
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WWQ0 (5-End)
      • expression tag (3-4)
    Domains in SCOPe 2.08: d5enia1, d5enia2
  • Heterogens: 5QA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5eniA (A:)
yfqsmsydiqawkkqceellnlifqcedsepfrqpvdlleypdyrdiidtpmdfatvret
leagnyespmelckdvrlifsnskaytpskrsriysmslrlsaffeehissvlsdyksal
rfhkrntitkr

    Sequence, based on observed residues (ATOM records): (download) 
    >5eniA (A:)
smsydiqawkkqceellnlifqcedsepfrqpvdlleypdyrdiidtpmdfatvretlea
gnyespmelckdvrlifsnskaytpskrsriysmslrlsaffeehissvlsdyksalrfh
krn