PDB entry 5end

View 5end on RCSB PDB site
Description: Crystal structure of beta-ketoacyl-acyl carrier protein reductase (FabG)(Q152A) from Vibrio cholerae
Class: oxidoreductase
Keywords: STRUCTURAL GENOMICS, CENTER FOR STRUCTURAL GENOMICS OF INFECTIOUS DISEASES, CSGID, Vibrio cholerae, FabG, beta-ketoacyl-acyl carrier protein reductase, OXIDOREDUCTASE
Deposited on 2015-11-09, released 2015-12-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-23, with a file datestamp of 2015-12-18.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier-protein] reductase FabG
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: fabG, VC_2021
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KQH7 (4-End)
      • expression tag (2-3)
      • engineered mutation (151)
    Domains in SCOPe 2.06: d5enda1, d5enda2
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier-protein] reductase FabG
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: fabG, VC_2021
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KQH7 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.06: d5endb1, d5endb2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5endA (A:)
    msqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgm
    alnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnltsifr
    lskavlrgmmkkrqgriinvgsvvgtmgnagaanyaaakagvigftksmarevasrgvtv
    ntvapgfietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitgetlh
    vnggmymi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5endA (A:)
    qfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgmal
    nvtnpesieavlkaitdefggvdilvnnamkeeewsdimetnltsifrlskavlrgmmkk
    rqgriinvgsvvgaanyaaakagvigftksmarevasrgvtvntvapgfietdmtkalnd
    eqrtatlaqvpagrlgdpreiasavaflaspeaayitgetlhvnggmy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5endB (B:)
    msqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgm
    alnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnltsifr
    lskavlrgmmkkrqgriinvgsvvgtmgnagaanyaaakagvigftksmarevasrgvtv
    ntvapgfietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitgetlh
    vnggmymi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5endB (B:)
    sqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgma
    lnvtnpesieavlkaitdefggvdilvnnakeeewsdimetnltsifrlskavlrgmmkk
    rqgriinvgsvvanyaaakagvigftksmarevasrgvtvntvapgfietdmtkalndeq
    rtatlaqvpagrlgdpreiasavaflaspeaayitgetlhvnggmy