PDB entry 5en4

View 5en4 on RCSB PDB site
Description: Complex of 17-beta-hydroxysteroid dehydrogenase type 14 with inhibitor.
Class: oxidoreductase
Keywords: inhibitor complex, steroid dehydrogenase, oxidoreductase
Deposited on 2015-11-09, released 2016-11-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-11-23, with a file datestamp of 2016-11-18.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 17-beta-hydroxysteroid dehydrogenase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD17B14, DHRS10, SDR3, SDR47C1, UNQ502/PRO474
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5en4a_
  • Heterogens: NAD, 5Q6, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5en4A (A:)
    matgtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfil
    cdvtqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtyt
    ltklalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvn
    cispgniwtplweelaalmpdpratiregmlaqplgrmgqpaevgaaavflaseanfctg
    iellvtggaelgygckasrstpvdapdips
    

    Sequence, based on observed residues (ATOM records): (download)
    >5en4A (A:)
    gtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdv
    tqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltk
    lalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncis
    pgniwtplweelaalmpdpratiregmlaqplgrmgqpaevgaaavflaseanfctgiel
    lvtggaelgyg