PDB entry 5elf

View 5elf on RCSB PDB site
Description: Cholera toxin El Tor B-pentamer in complex with A-pentasaccharide
Class: toxin
Keywords: Cholera toxin B-pentamer, Human milk oligosaccharide, complex, blood group oligosaccharide/antigen, toxin
Deposited on 2015-11-04, released 2016-03-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5elfa_
  • Chain 'B':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5elfb_
  • Chain 'C':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5elfc_
  • Chain 'D':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5elfd_
  • Chain 'E':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5elfe_
  • Chain 'F':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5elff_
  • Chain 'G':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5elfg_
  • Chain 'H':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5elfh_
  • Chain 'I':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5elfi_
  • Chain 'J':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5elfj_
  • Heterogens: CA, BCN, FUC, GLC, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5elfA (A:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5elfB (B:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5elfC (C:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5elfD (D:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5elfE (E:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5elfF (F:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5elfG (G:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5elfH (H:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5elfI (I:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5elfJ (J:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman