PDB entry 5eld

View 5eld on RCSB PDB site
Description: Cholera toxin classical B-pentamer in complex with A Lewis-y
Class: toxin
Keywords: Cholera toxin B-pentamer, A Lewis-y, complex, blood group oligosaccharide/antigen, toxin
Deposited on 2015-11-04, released 2016-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-05-11, with a file datestamp of 2016-05-06.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cholera enterotoxin B subunit
    Species: Vibrio cholerae O1 [TaxId:127906]
    Gene: CTXB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5elda_
  • Chain 'B':
    Compound: Cholera enterotoxin B subunit
    Species: Vibrio cholerae O1 [TaxId:127906]
    Gene: CTXB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5eldb_
  • Chain 'C':
    Compound: Cholera enterotoxin B subunit
    Species: Vibrio cholerae O1 [TaxId:127906]
    Gene: CTXB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5eldc_
  • Chain 'D':
    Compound: Cholera enterotoxin B subunit
    Species: Vibrio cholerae O1 [TaxId:127906]
    Gene: CTXB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5eldd_
  • Chain 'E':
    Compound: Cholera enterotoxin B subunit
    Species: Vibrio cholerae O1 [TaxId:127906]
    Gene: CTXB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5elde_
  • Heterogens: PEG, GAL, NDG, A2G, FUC, NA, MES, PGE, GLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5eldA (A:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5eldB (B:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5eldC (C:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5eldD (D:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5eldE (E:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman