PDB entry 5eld
View 5eld on RCSB PDB site
Description: Cholera toxin classical B-pentamer in complex with A Lewis-y
Class: toxin
Keywords: Cholera toxin B-pentamer, A Lewis-y, complex, blood group oligosaccharide/antigen, toxin
Deposited on
2015-11-04, released
2016-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated
2016-05-11, with a file datestamp of
2016-05-06.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Cholera enterotoxin B subunit
Species: Vibrio cholerae O1 [TaxId:127906]
Gene: CTXB
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d5elda_ - Chain 'B':
Compound: Cholera enterotoxin B subunit
Species: Vibrio cholerae O1 [TaxId:127906]
Gene: CTXB
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d5eldb_ - Chain 'C':
Compound: Cholera enterotoxin B subunit
Species: Vibrio cholerae O1 [TaxId:127906]
Gene: CTXB
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d5eldc_ - Chain 'D':
Compound: Cholera enterotoxin B subunit
Species: Vibrio cholerae O1 [TaxId:127906]
Gene: CTXB
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d5eldd_ - Chain 'E':
Compound: Cholera enterotoxin B subunit
Species: Vibrio cholerae O1 [TaxId:127906]
Gene: CTXB
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d5elde_ - Heterogens: PEG, GAL, NDG, A2G, FUC, NA, MES, PGE, GLA, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>5eldA (A:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>5eldB (B:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>5eldC (C:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>5eldD (D:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>5eldE (E:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman