PDB entry 5elc

View 5elc on RCSB PDB site
Description: Cholera toxin El Tor B-pentamer in complex with Lewis-y
Class: toxin
Keywords: Cholera toxin B-pentamer, Lewis-y, complex, blood group oligosaccharide/antigen, toxin
Deposited on 2015-11-04, released 2016-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-27, with a file datestamp of 2016-04-22.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5elca_
  • Chain 'B':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5elcb_
  • Chain 'C':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5elcc_
  • Chain 'D':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5elcd_
  • Chain 'E':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5elce_
  • Chain 'F':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5elcf_
  • Chain 'G':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5elcg_
  • Chain 'H':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5elch_
  • Chain 'I':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5elci_
  • Chain 'J':
    Compound: Cholera enterotoxin subunit B
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: ctxB, toxB, VC_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5elcj_
  • Heterogens: CA, BCN, GAL, NDG, FUC, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5elcA (A:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5elcB (B:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5elcC (C:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5elcD (D:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5elcE (E:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5elcF (F:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5elcG (G:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5elcH (H:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5elcI (I:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5elcJ (J:)
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman