PDB entry 5ejw

View 5ejw on RCSB PDB site
Description: Crystal structure of chromobox homolog 7 (CBX7) chromodomain with MS351
Class: transcription/inhibitor
Keywords: transcription, inhibitor, TRANSCRIPTION-INHIBITOR complex
Deposited on 2015-11-02, released 2016-03-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-03-09, with a file datestamp of 2016-03-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromobox protein homolog 7
    Species: Mus musculus [TaxId:10090]
    Gene: Cbx7, D15Ertd417e
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VDS3 (20-End)
      • expression tag (8-19)
    Domains in SCOPe 2.06: d5ejwa1, d5ejwa2
  • Heterogens: 5PZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5ejwA (A:)
mgsshhhhhhssglvprgshmelsaigeqvfavesirkkrvrkgkveylvkwkgwppkys
twepeehildprlvmayeekeerdrasgyrk

    Sequence, based on observed residues (ATOM records): (download) 
    >5ejwA (A:)
hhssglvprgshmelsaigeqvfavesirkkrvrkgkveylvkwkgwppkystwepeehi
ldprlvmayeekeerdrasg