PDB entry 5eiz

View 5eiz on RCSB PDB site
Description: Crystal structure of Y99A mutant of human macrophage migration inhibitory factor
Class: isomerase
Keywords: Isomerase, surface, mutation
Deposited on 2015-10-30, released 2015-11-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-11-11, with a file datestamp of 2015-11-06.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: MIF, GLIF, MMIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (0-113)
      • engineered mutation (98)
    Domains in SCOPe 2.05: d5eiza_
  • Chain 'B':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: MIF, GLIF, MMIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (0-113)
      • engineered mutation (98)
    Domains in SCOPe 2.05: d5eizb_
  • Chain 'C':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: MIF, GLIF, MMIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (0-113)
      • engineered mutation (98)
    Domains in SCOPe 2.05: d5eizc_
  • Heterogens: GOL, SO4, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5eizA (A:)
    pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
    lhsigkiggaqnrsyskllcgllaerlrispdrvyinyadmnaanvgwnnstfa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5eizB (B:)
    pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
    lhsigkiggaqnrsyskllcgllaerlrispdrvyinyadmnaanvgwnnstfa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5eizC (C:)
    pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
    lhsigkiggaqnrsyskllcgllaerlrispdrvyinyadmnaanvgwnnstfa