PDB entry 5eg4

View 5eg4 on RCSB PDB site
Description: bovine trypsin in complex with cyclic inhibitor
Class: hydrolase
Keywords: METAL-BINDING, DIGESTION, HYDROLASE-HYDROLASE INHIBITOR COMPLEX, hydrolase
Deposited on 2015-10-26, released 2016-07-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-07-13, with a file datestamp of 2016-07-08.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5eg4a_
  • Heterogens: CA, SO4, ACT, 5N7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5eg4A (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn