PDB entry 5efw
View 5efw on RCSB PDB site
Description: Crystal structure of LOV2-Zdk1 - the complex of oat LOV2 and the affibody protein Zdark1
Class: signaling protein
Keywords: LOV domain, photoreceptor, affibody, optogenetic tool, signaling protein
Deposited on
2014-09-10, released
2016-07-20
The last revision prior to the SCOPe 2.08 freeze date was dated
2018-01-31, with a file datestamp of
2018-01-26.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: nph1-1
Species: AVENA SATIVA [TaxId:4498]
Gene: NPH1-1
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Z-dark, a small protein based on the Z domain affibody
Species: Staphylococcus aureus [TaxId:1280]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d5efwb_ - Chain 'C':
Compound: Z-dark, a small protein based on the Z domain affibody
Species: Staphylococcus aureus [TaxId:1280]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d5efwc_ - Heterogens: FMN, SO4, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence, based on SEQRES records: (download)
>5efwB (B:)
gsvdnkfnkektragaeihslpnlnveqkfafivslfddpsqsanllaeakklndaqapk
Sequence, based on observed residues (ATOM records): (download)
>5efwB (B:)
kfnkektragaeihslpnlnveqkfafivslfddpsqsanllaeakklndaqapk
- Chain 'C':
Sequence, based on SEQRES records: (download)
>5efwC (C:)
gsvdnkfnkektragaeihslpnlnveqkfafivslfddpsqsanllaeakklndaqapk
Sequence, based on observed residues (ATOM records): (download)
>5efwC (C:)
tragaeihslpnlnveqkfafivslfddpsqsanllaeakklndaqapk