PDB entry 5efw

View 5efw on RCSB PDB site
Description: Crystal structure of LOV2-Zdk1 - the complex of oat LOV2 and the affibody protein Zdark1
Class: signaling protein
Keywords: LOV domain, photoreceptor, affibody, optogenetic tool, signaling protein
Deposited on 2014-09-10, released 2016-07-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nph1-1
    Species: AVENA SATIVA [TaxId:4498]
    Gene: NPH1-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O49003 (Start-144)
      • engineered mutation (48)
  • Chain 'B':
    Compound: Z-dark, a small protein based on the Z domain affibody
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • PDB 5EFW (Start-59)
    Domains in SCOPe 2.08: d5efwb_
  • Chain 'C':
    Compound: Z-dark, a small protein based on the Z domain affibody
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • PDB 5EFW (Start-59)
    Domains in SCOPe 2.08: d5efwc_
  • Heterogens: FMN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5efwB (B:)
    gsvdnkfnkektragaeihslpnlnveqkfafivslfddpsqsanllaeakklndaqapk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5efwB (B:)
    kfnkektragaeihslpnlnveqkfafivslfddpsqsanllaeakklndaqapk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5efwC (C:)
    gsvdnkfnkektragaeihslpnlnveqkfafivslfddpsqsanllaeakklndaqapk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5efwC (C:)
    tragaeihslpnlnveqkfafivslfddpsqsanllaeakklndaqapk