PDB entry 5eeo

View 5eeo on RCSB PDB site
Description: soybean lipoxygenase(L1)-T756R
Class: oxidoreductase
Keywords: Oxidoreductase
Deposited on 2015-10-23, released 2015-11-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-11-25, with a file datestamp of 2015-11-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Seed linoleate 13S-lipoxygenase-1
    Species: Glycine max [TaxId:3847]
    Gene: LOX1.1, LOX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08170 (Start-838)
      • engineered mutation (755)
    Domains in SCOPe 2.06: d5eeoa1, d5eeoa2
  • Heterogens: FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5eeoA (A:)
    mfsaghkikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgk
    dtflegintslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnq
    gtirfvcnswvyntklyksvriffanhtyvpsetpaplvsyreeelkslrgngtgerkey
    driydydvyndlgnpdkseklarpvlggsstfpyprrgrtgrgptvtdpntekqgevfyv
    prdenlghlkskdaleigtkslsqivqpafesafdlkstpiefhsfqdvhdlyeggiklp
    rdvistiiplpvikelyrtdgqhilkfpqphvvqvsqsawmtdeefaremiagvnpcvir
    gleefppksnldpaiygdqsskitadsldldgytmdealgsrrlfmldyhdifmpyvrqi
    nqlnsaktyatrtilflredgtlkpvaielslphsagdlsaavsqvvlpakegvestiwl
    lakayvivndscyhqlmshwlnthaamepfviathrhlsvlhpiyklltphyrnnmnina
    larqslinangiiettflpskysvemssavyknwvftdqalpadlikrgvaikdpstphg
    vrlliedypyaadgleiwaaiktwvqeyvplyyardddvkndselqhwwkeavekghgdl
    kdkpwwpklqtledlvevcliiiwiasalhaavnfgqypygglimnrptasrrllpekgt
    peyeeminnhekaylrtitsklptlislsvieilsrhasdevylgqrdnphwtsdskalq
    afqkfgnklkeieeklvrrnndpslqgnrlgpvqlpytllypsseegltfrgipnsisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5eeoA (A:)
    hkikgtvvlmpknelnlnaflgrsvslqlisatkadahgkgkvgkdtflegintlgages
    afnihfewdgsmgipgafyiknymqvefflksltleagtirfvcnswvyntklyksvrif
    fanhtyvpsetpaplvsyreeelkslrgngtgerkeydriydydvyndlgnpdkseklar
    pvlggsstfpyprrgrtgrgptvtdpntekqgevfyvprdenlghlkskdaleigtksls
    qivqpafesafdlkstpiefhsfqdvhdlyeggiklprdvistiiplpvikelyrtdgqh
    ilkfpqphvvqvsqsawmtdeefaremiagvnpcvirgleefppksnldpqsskitadsl
    dldgytmdealgsrrlfmldyhdifmpyvrqinqlnsaktyatrtilflredgtlkpvai
    elslphsagdsqvvlpakegvestiwllakayvivndscyhqlmshwlnthaamepfvia
    thrhlsvlhpiyklltphyrnnmninalarqslinangiiettflpskysvemssavykn
    wvftdqalpadlikrgvaikdpstphgvrlliedypyaadgleiwaaiktwvqeyvplyy
    ardddvkndselqhwwkeavekghgdlkdkpwwpklqtledlvevcliiiwiasalhaav
    nfgqypygglimnrptasrrllpekgtpeyeeminnhekaylrtitsklptlislsviei
    lsrhasdevylgqrdnphwtsdskalqafqkfgnklkeieeklvrrnndpslqgnrlgpv
    qlpytllypsseegltfrgipnsisi