PDB entry 5eeh

View 5eeh on RCSB PDB site
Description: Crystal structure of carminomycin-4-O-methyltransferase DnrK in complex with SAH and 2-chloro-4-nitrophenol
Class: transferase
Keywords: unnatural substrate, Structural Genomics, PSI-Biology, Protein Structure Initiative, Enzyme Discovery for Natural Product Biosynthesis, NatPro, TRANSFERASE
Deposited on 2015-10-22, released 2015-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carminomycin 4-O-methyltransferase DnrK
    Species: Streptomyces peucetius [TaxId:1950]
    Gene: dnrk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5eeha1, d5eeha2
  • Chain 'B':
    Compound: Carminomycin 4-O-methyltransferase DnrK
    Species: Streptomyces peucetius [TaxId:1950]
    Gene: dnrk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5eehb1, d5eehb2
  • Chain 'C':
    Compound: Carminomycin 4-O-methyltransferase DnrK
    Species: Streptomyces peucetius [TaxId:1950]
    Gene: dnrk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5eehc1, d5eehc2
  • Heterogens: SAH, P9P, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5eehA (A:)
    mgsshhhhhhssglvprgshmtaeptvaarpqqidalrtlirlgslhtpmvvrtaatlrl
    vdhilagartvkalaartdtrpeallrlirhlvaiglleedapgefvptevgelladdhp
    aaqrawhdltqavaradisftrlpdairtgrptyesiygkpfyedlagrpdlrasfdsll
    acdqdvafdapaaaydwtnvrhvldvgggkggfaaaiarraphvsatvlemagtvdtars
    ylkdeglsdrvdvvegdffeplprkadaiilsfvllnwpdhdavriltrcaealepggri
    liherddlhensfneqfteldlrmlvflggalrtrekwdglaasaglvveevrqlpspti
    pydlsllvlapaatga
    

    Sequence, based on observed residues (ATOM records): (download)
    >5eehA (A:)
    pqqidalrtlirlgslhtpmvvrtaatlrlvdhilagartvkalaartdtrpeallrlir
    hlvaiglleedapgefvptevgelladdhpaaqrawhdltqavaradisftrlpdairtg
    rptyesiygkpfyedlagrpdlrasfdsllacdqdvafdapaaaydwtnvrhvldvgggk
    ggfaaaiarraphvsatvlemagtvdtarsylkdeglsdrvdvvegdffeplprkadaii
    lsfvllnwpdhdavriltrcaealepggriliherddlhensfneqfteldlrmlvflgg
    alrtrekwdglaasaglvveevrqlpsptipydlsllvlapa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5eehB (B:)
    mgsshhhhhhssglvprgshmtaeptvaarpqqidalrtlirlgslhtpmvvrtaatlrl
    vdhilagartvkalaartdtrpeallrlirhlvaiglleedapgefvptevgelladdhp
    aaqrawhdltqavaradisftrlpdairtgrptyesiygkpfyedlagrpdlrasfdsll
    acdqdvafdapaaaydwtnvrhvldvgggkggfaaaiarraphvsatvlemagtvdtars
    ylkdeglsdrvdvvegdffeplprkadaiilsfvllnwpdhdavriltrcaealepggri
    liherddlhensfneqfteldlrmlvflggalrtrekwdglaasaglvveevrqlpspti
    pydlsllvlapaatga
    

    Sequence, based on observed residues (ATOM records): (download)
    >5eehB (B:)
    qidalrtlirlgslhtpmvvrtaatlrlvdhilagartvkalaartdtrpeallrlirhl
    vaiglleedapgefvptevgelladdhpaaqrawhdltqavaradisftrlpdairtgrp
    tyesiygkpfyedlagrpdlrasfdsllacdqdvafdapaaaydwtnvrhvldvgggkgg
    faaaiarraphvsatvlemagtvdtarsylkdeglsdrvdvvegdffeplprkadaiils
    fvllnwpdhdavriltrcaealepggriliherddlhensfneqfteldlrmlvflggal
    rtrekwdglaasaglvveevrqlpsptipydlsllvlapa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5eehC (C:)
    mgsshhhhhhssglvprgshmtaeptvaarpqqidalrtlirlgslhtpmvvrtaatlrl
    vdhilagartvkalaartdtrpeallrlirhlvaiglleedapgefvptevgelladdhp
    aaqrawhdltqavaradisftrlpdairtgrptyesiygkpfyedlagrpdlrasfdsll
    acdqdvafdapaaaydwtnvrhvldvgggkggfaaaiarraphvsatvlemagtvdtars
    ylkdeglsdrvdvvegdffeplprkadaiilsfvllnwpdhdavriltrcaealepggri
    liherddlhensfneqfteldlrmlvflggalrtrekwdglaasaglvveevrqlpspti
    pydlsllvlapaatga
    

    Sequence, based on observed residues (ATOM records): (download)
    >5eehC (C:)
    pqqidalrtlirlgslhtpmvvrtaatlrlvdhilagartvkalaartdtrpeallrlir
    hlvaiglleedapgefvptevgelladdhpaaqrawhdltqavaradisftrlpdairtg
    rptyesiygkpfyedlagrpdlrasfdsllacdqdvafdapaaaydwtnvrhvldvgggk
    ggfaaaiarraphvsatvlemagtvdtarsylkdeglsdrvdvvegdffeplprkadaii
    lsfvllnwpdhdavriltrcaealepggriliherddlhensfneqfteldlrmlvflgg
    alrtrekwdglaasaglvveevrqlpsptipydlsllvlapaa