PDB entry 5ee5

View 5ee5 on RCSB PDB site
Description: Structure of human ARL1 in complex with the DCB domain of BIG1
Class: transcription
Keywords: ARF1-GEF ARL1-effector Trans-golgi DCB domain, transcription
Deposited on 2015-10-22, released 2016-07-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-07-27, with a file datestamp of 2016-07-22.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Brefeldin A-inhibited guanine nucleotide-exchange protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ARFGEF1, ARFGEP1, BIG1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ADP-ribosylation factor-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ARL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40616
      • conflict (60)
    Domains in SCOPe 2.08: d5ee5b_
  • Heterogens: NA, GOL, CL, GTP, MG, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >5ee5B (B:)
gshmtremrililgldgagkttilyrlqvgevvttiptigfnvetvtyknlkfqvwdlgg
ltsirpywrcyysntdaviyvvdscdrdrigiskselvamleeeelrkailvvfankqdm
eqamtssemanslglpalkdrkwqifktsatkgtgldeamewlvetlksrq

    Sequence, based on observed residues (ATOM records): (download) 
    >5ee5B (B:)
emrililgldgagkttilyrlqvgevvttiptigfnvetvtyknlkfqvwdlggltsirp
ywrcyysntdaviyvvdscdrdrigiskselvamleeeelrkailvvfankqdmeqamts
semanslglpalkdrkwqifktsatkgtgldeamewlvetlksr