PDB entry 5edg

View 5edg on RCSB PDB site
Description: human PDE10A in complex with 3-(2-Chloro-5-phenyl-3H-imidazol-4-yl)-1-(3-trifluoromethoxy-phenyl)-1H-pyridazin-4-one at 2.30A
Class: hydrolase
Keywords: phosphodiesterase, pde10, hydrolase
Deposited on 2015-10-21, released 2016-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-05-25, with a file datestamp of 2016-05-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE10A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y233 (Start-314)
      • conflict (14)
    Domains in SCOPe 2.07: d5edga_
  • Chain 'B':
    Compound: cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE10A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y233 (1-314)
      • conflict (14)
      • expression tag (315)
    Domains in SCOPe 2.07: d5edgb1, d5edgb2
  • Chain 'C':
    Compound: cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE10A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y233 (Start-314)
      • conflict (14)
    Domains in SCOPe 2.07: d5edgc_
  • Chain 'D':
    Compound: cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE10A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y233 (1-End)
      • expression tag (0)
      • conflict (14)
    Domains in SCOPe 2.07: d5edgd1, d5edgd2
  • Heterogens: ZN, MG, 5MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5edgA (A:)
    aqglmqftlpvrlcreielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsv
    kknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsyl
    qkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdl
    alyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyae
    fwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkac
    rdnlsqwekvirgee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5edgA (A:)
    glmqftlpvrlcreielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsvkk
    nyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsylqk
    fdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlal
    yfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyaefw
    aegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkacrd
    nlsqwekvirgee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5edgB (B:)
    aqglmqftlpvrlcreielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsv
    kknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsyl
    qkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdl
    alyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyae
    fwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkac
    rdnlsqwekvirgeea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5edgB (B:)
    qglmqftlpvrlcreielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsvk
    knyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsylq
    kfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdla
    lyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyaef
    waegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkacr
    dnlsqwekvirgeea
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5edgC (C:)
    aqglmqftlpvrlcreielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsv
    kknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsyl
    qkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdl
    alyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyae
    fwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkac
    rdnlsqwekvirgee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5edgC (C:)
    glmqftlpvrlcreielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsvkk
    nyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsylqk
    fdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlal
    yfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyaefw
    aegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkacrd
    nlsqwekvirgee
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5edgD (D:)
    aqglmqftlpvrlcreielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsv
    kknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsyl
    qkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdl
    alyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyae
    fwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkac
    rdnlsqwekvirgee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5edgD (D:)
    aqglmqftlpvrlcreielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsv
    kknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsyl
    qkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdl
    alyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyae
    fwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkac
    rdnlsqwekvirg