PDB entry 5ede

View 5ede on RCSB PDB site
Description: human PDE10A in complex with 1-(4-Chloro-phenyl)-3-methyl-1H-thieno[2,3-c]pyrazole-5-carboxylic acid (tetrahydro-furan-2-ylmethyl)-amide at 2.2A
Class: hydrolase
Keywords: phosphodiesterase, pde10, hydrolase
Deposited on 2015-10-21, released 2016-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-05-25, with a file datestamp of 2016-05-20.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE10A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y233 (1-314)
      • conflict (14)
    Domains in SCOPe 2.07: d5edea_
  • Chain 'B':
    Compound: cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE10A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y233 (1-313)
      • expression tag (0)
      • conflict (13)
      • expression tag (314)
    Domains in SCOPe 2.07: d5edeb1, d5edeb2, d5edeb3
  • Chain 'C':
    Compound: cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE10A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y233 (Start-314)
      • conflict (14)
    Domains in SCOPe 2.07: d5edec_
  • Chain 'D':
    Compound: cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE10A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y233 (1-End)
      • expression tag (0)
      • conflict (14)
    Domains in SCOPe 2.07: d5eded1, d5eded2
  • Heterogens: ZN, MG, GOL, 5M6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5edeA (A:)
    aqglmqftlpvrlcreielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsv
    kknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsyl
    qkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdl
    alyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyae
    fwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkac
    rdnlsqwekvirgeea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5edeA (A:)
    qglmqftlpvrlcreielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsvk
    knyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsylq
    kfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdla
    lyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyaef
    waegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkacr
    dnlsqwekvirgee
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5edeB (B:)
    aglmqftlpvrlcreielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsvk
    knyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsylq
    kfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdla
    lyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyaef
    waegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkacr
    dnlsqwekvirgeea
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5edeC (C:)
    aqglmqftlpvrlcreielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsv
    kknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsyl
    qkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdl
    alyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyae
    fwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkac
    rdnlsqwekvirgeea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5edeC (C:)
    glmqftlpvrlcreielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsvkk
    nyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsylqk
    fdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlal
    yfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyaefw
    aegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkacrd
    nlsqwekvirgee
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5edeD (D:)
    aqglmqftlpvrlcreielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsv
    kknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsyl
    qkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdl
    alyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyae
    fwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkac
    rdnlsqwekvirgeea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5edeD (D:)
    aqglmqftlpvrlcreielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsv
    kknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsyl
    qkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdl
    alyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyae
    fwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkac
    rdnlsqwekvirg