PDB entry 5ect

View 5ect on RCSB PDB site
Description: Mycobacterium tuberculosis dUTPase G143STOP mutant
Class: hydrolase
Keywords: hydrolase, jelly-roll, trimer
Deposited on 2015-10-20, released 2016-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: dut, Rv2697c, MTCY05A6.18c
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WNS5 (20-End)
      • expression tag (11-19)
    Domains in SCOPe 2.07: d5ecta1, d5ecta2
  • Heterogens: DUP, TRS, MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ectA (A:)
    mgsshhhhhhssglvprgshmsttlaivrldpglplpsrahdgdagvdlysaedvelapg
    rralvrtgvavavpfgmvglvhprsglatrvglsivnspgtidagyrgeikvalinldpa
    apivvhrgdriaqllvqrvelvelvevssfdeaglastsrgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ectA (A:)
    sglvprgshmsttlaivrldpglplpsrahdgdagvdlysaedvelapgrralvrtgvav
    avpfgmvglvhprsglatrvglsivnspgtidagyrgeikvalinldpaapivvhrgdri
    aqllvqrvelvelvevssfdeatsrg