PDB entry 5ecl

View 5ecl on RCSB PDB site
Description: Crystal Structure of FIN219-FIP1 complex with JA, Ile and Mg
Class: ligase/transferase
Keywords: Jasmonate-amido synthetase, Glutathione S-transferase, Ligase-Transferase complex
Deposited on 2015-10-20, released 2016-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-22, with a file datestamp of 2017-03-17.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Jasmonic acid-amido synthetase JAR1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: JAR1, FIN219, At2g46370, F11C10.6
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Glutathione S-transferase U20
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: GSTU20, FIP1, At1g78370, F3F9.11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5eclb1, d5eclb2
  • Chain 'C':
    Compound: Glutathione S-transferase U20
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: GSTU20, FIP1, At1g78370, F3F9.11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5eclc1, d5eclc2
  • Chain 'D':
    Compound: Jasmonic acid-amido synthetase JAR1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: JAR1, FIN219, At2g46370, F11C10.6
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Glutathione S-transferase U20
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: GSTU20, FIP1, At1g78370, F3F9.11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ecle1, d5ecle2
  • Chain 'F':
    Compound: Glutathione S-transferase U20
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: GSTU20, FIP1, At1g78370, F3F9.11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5eclf1, d5eclf2
  • Heterogens: JAA, ILE, MG, GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5eclB (B:)
    hhhhhhmanlpilldywpsmfgmrarvalrekgvefeyreedfsnksplllqsnpihkki
    pvlvhngkpvceslnvvqyvdeawpeknpffpsdpygraqarfwadfvdkkftdaqfkvw
    gkkgeeqeagkkefieavkileselgdkpyfggdsfgyvdislitfsswfqayekfgnfs
    iesespkliawakrcmekesvskslpdsekivayaaeyrknnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5eclB (B:)
    lpilldywpsmfgmrarvalrekgvefeyreedfsnksplllqsnpihkkipvlvhngkp
    vceslnvvqyvdeawpeknpffpsdpygraqarfwadfvdkkftdaqfkvwgkkgeeqea
    gkkefieavkileselgdkpyfggdsfgyvdislitfsswfqayekfgnfsiesespkli
    awakrcmekesvskslpdsekivayaaeyrknnl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5eclC (C:)
    hhhhhhmanlpilldywpsmfgmrarvalrekgvefeyreedfsnksplllqsnpihkki
    pvlvhngkpvceslnvvqyvdeawpeknpffpsdpygraqarfwadfvdkkftdaqfkvw
    gkkgeeqeagkkefieavkileselgdkpyfggdsfgyvdislitfsswfqayekfgnfs
    iesespkliawakrcmekesvskslpdsekivayaaeyrknnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5eclC (C:)
    lpilldywpsmfgmrarvalrekgvefeyreedfsnksplllqsnpihkkipvlvhngkp
    vceslnvvqyvdeawpeknpffpsdpygraqarfwadfvdkkftdaqfkvwgkkgeeqea
    gkkefieavkileselgdkpyfggdsfgyvdislitfsswfqayekfgnfsiesespkli
    awakrcmekesvskslpdsekivayaaeyrknnl
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5eclE (E:)
    hhhhhhmanlpilldywpsmfgmrarvalrekgvefeyreedfsnksplllqsnpihkki
    pvlvhngkpvceslnvvqyvdeawpeknpffpsdpygraqarfwadfvdkkftdaqfkvw
    gkkgeeqeagkkefieavkileselgdkpyfggdsfgyvdislitfsswfqayekfgnfs
    iesespkliawakrcmekesvskslpdsekivayaaeyrknnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5eclE (E:)
    lpilldywpsmfgmrarvalrekgvefeyreedfsnksplllqsnpihkkipvlvhngkp
    vceslnvvqyvdeawpeknpffpsdpygraqarfwadfvdkkftdaqfkvwgkkgeeqea
    gkkefieavkileselgdkpyfggdsfgyvdislitfsswfqayekfgnfsiesespkli
    awakrcmekesvskslpdsekivayaaeyrknnl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5eclF (F:)
    hhhhhhmanlpilldywpsmfgmrarvalrekgvefeyreedfsnksplllqsnpihkki
    pvlvhngkpvceslnvvqyvdeawpeknpffpsdpygraqarfwadfvdkkftdaqfkvw
    gkkgeeqeagkkefieavkileselgdkpyfggdsfgyvdislitfsswfqayekfgnfs
    iesespkliawakrcmekesvskslpdsekivayaaeyrknnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5eclF (F:)
    lpilldywpsmfgmrarvalrekgvefeyreedfsnksplllqsnpihkkipvlvhngkp
    vceslnvvqyvdeawpeknpffpsdpygraqarfwadfvdkkftdaqfkvwgkkgeeqea
    gkkefieavkileselgdkpyfggdsfgyvdislitfsswfqayekfgnfsiesespkli
    awakrcmekesvskslpdsekivayaaeyrknnl