PDB entry 5ecj

View 5ecj on RCSB PDB site
Description: Crystal structure of monobody Mb(S4) bound to Prdm14 in complex with Mtgr1
Class: gene regulation/transcription
Keywords: TRANSFERASE, PROTEIN BINDING, GENE REGULATION-TRANSCRIPTION complex
Deposited on 2015-10-20, released 2015-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PR domain zinc finger protein 14,Protein CBFA2T2
    Species: Mus musculus [TaxId:10090]
    Gene: Cbfa2t2, Cbfa2t2h, Mtgr1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: PR domain zinc finger protein 14,Protein CBFA2T2
    Species: Mus musculus [TaxId:10090]
    Gene: Cbfa2t2, Cbfa2t2h, Mtgr1
    Database cross-references and differences (RAF-indexed):
    • Uniprot E9Q3T6 (Start-191)
      • linker (195-199)
    • Uniprot O70374 (200-End)
  • Chain 'E':
    Compound: Monobody Mb(S4)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5ECJ (Start-94)
    Domains in SCOPe 2.07: d5ecje_
  • Chain 'F':
    Compound: Monobody Mb(S4)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5ECJ (Start-94)
    Domains in SCOPe 2.07: d5ecjf_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5ecjE (E:)
    gsvssvptklevvaatptslliswdapavtvdlyfitygetggnspvqkftvpgskstat
    isglkpgvdytitvyaqyyyrgwyvgspisinyrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ecjE (E:)
    vssvptklevvaatptslliswdapavtvdlyfitygetggnspvqkftvpgskstatis
    glkpgvdytitvyaqyyyrgwyvgspisinyrt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5ecjF (F:)
    gsvssvptklevvaatptslliswdapavtvdlyfitygetggnspvqkftvpgskstat
    isglkpgvdytitvyaqyyyrgwyvgspisinyrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ecjF (F:)
    vssvptklevvaatptslliswdapavtvdlyfitygetggnspvqkftvpgskstatis
    glkpgvdytitvyaqyyyrgwyvgspisinyrt