PDB entry 5ec7

View 5ec7 on RCSB PDB site
Description: Crystal structure of a chimeric c-Src-SH3 domain with the sequence of the RT-loop from the Abl-SH3 domain at pH 5.0
Class: transferase
Keywords: beta shandwich, transferase
Deposited on 2015-10-20, released 2016-11-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-11-09, with a file datestamp of 2016-11-04.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (1-56)
      • initiating methionine (0)
      • engineered mutation (9-11)
      • conflict (12)
      • engineered mutation (44)
    Domains in SCOPe 2.06: d5ec7a_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (1-56)
      • initiating methionine (0)
      • engineered mutation (9-11)
      • conflict (12)
      • engineered mutation (44)
    Domains in SCOPe 2.06: d5ec7b_
  • Chain 'C':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (1-End)
      • engineered mutation (9-11)
      • conflict (12)
      • engineered mutation (44)
    Domains in SCOPe 2.06: d5ec7c_
  • Heterogens: PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ec7A (A:)
    mtfvalydyvasgetdlsfkkgerlqivnntegdwwlahslttgrtgyipsnyvaps
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ec7B (B:)
    mtfvalydyvasgetdlsfkkgerlqivnntegdwwlahslttgrtgyipsnyvaps
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ec7C (C:)
    mtfvalydyvasgetdlsfkkgerlqivnntegdwwlahslttgrtgyipsnyvaps
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ec7C (C:)
    tfvalydyvasgetdlsfkkgerlqivnntegdwwlahslttgrtgyipsnyvap