PDB entry 5ec3

View 5ec3 on RCSB PDB site
Description: Structural insight into the catalyitc mechanism of human 4-Hydroxyphenylpyruvate dioxygenase
Class: oxidoreductase
Keywords: 4-Hydroxyphenylpyruvate dioxygenase, drug discovery, OXIDOREDUCTASE
Deposited on 2015-10-20, released 2015-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-11-18, with a file datestamp of 2015-11-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-hydroxyphenylpyruvate dioxygenase
    Species: Homo sapiens [TaxId:9606]
    Gene: HPD, PPD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ec3a1, d5ec3a2
  • Heterogens: CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ec3A (A:)
    mttysdkgakpergrflhfhsvtfwvgnakqaasfycskmgfeplayrgletgsrevvsh
    vikqgkivfvlssalnpwnkemgdhlvkhgdgvkdiafevedcdyivqkarergakimre
    pwveqdkfgkvkfavlqtygdtthtlvekmnyigqflpgyeapafmdpllpklpkcslem
    idhivgnqpdqemvsasewylknlqfhrfwsvddtqvhteysslrsivvanyeesikmpi
    nepapgkkksqiqeyvdynggagvqhialktediitairhlrergleflsvpstyykqlr
    eklktakikvkenidaleelkilvdydekgyllqiftkpvqdrptlfleviqrhnhqgfg
    agnfnslfkafeeeqnlrgnltnmetngvvpgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ec3A (A:)
    akpergrflhfhsvtfwvgnakqaasfycskmgfeplayrgletgsrevvshvikqgkiv
    fvlssalnpwnkemgdhlvkhgdgvkdiafevedcdyivqkarergakimrepwveqdkf
    gkvkfavlqtygdtthtlvekmnyigqflpgyeapafmdpllpklpkcslemidhivgnq
    pdqemvsasewylknlqfhrfwsvddtqvhteysslrsivvanyeesikmpinepapgkk
    ksqiqeyvdynggagvqhialktediitairhlrergleflsvpstyykqlreklktaki
    kvkenidaleelkilvdydekgyllqiftkpvqdrptlfleviqrhnhqgfgagnfnslf
    kafeeeqnlrgnltnm