PDB entry 5ebu

View 5ebu on RCSB PDB site
Description: Aerococcus viridans L-lactate oxidase Y215F mutant
Class: oxidoreductase
Keywords: Flavin, lactate, oxidase, OXIDOREDUCTASE
Deposited on 2015-10-19, released 2016-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-29, with a file datestamp of 2016-06-24.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-lactate oxidase
    Species: Aerococcus viridans [TaxId:1377]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44467 (Start-373)
      • engineered mutation (101)
      • engineered mutation (162)
      • engineered mutation (214)
      • engineered mutation (231)
      • engineered mutation (254)
    Domains in SCOPe 2.07: d5ebua_
  • Chain 'B':
    Compound: L-lactate oxidase
    Species: Aerococcus viridans [TaxId:1377]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44467 (Start-373)
      • engineered mutation (101)
      • engineered mutation (162)
      • engineered mutation (214)
      • engineered mutation (231)
      • engineered mutation (254)
    Domains in SCOPe 2.07: d5ebub_
  • Chain 'C':
    Compound: L-lactate oxidase
    Species: Aerococcus viridans [TaxId:1377]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44467 (Start-373)
      • engineered mutation (101)
      • engineered mutation (162)
      • engineered mutation (214)
      • engineered mutation (231)
      • engineered mutation (254)
    Domains in SCOPe 2.07: d5ebuc_
  • Chain 'D':
    Compound: L-lactate oxidase
    Species: Aerococcus viridans [TaxId:1377]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44467 (Start-373)
      • engineered mutation (101)
      • engineered mutation (162)
      • engineered mutation (231)
      • engineered mutation (254)
    Domains in SCOPe 2.07: d5ebud_
  • Chain 'E':
    Compound: L-lactate oxidase
    Species: Aerococcus viridans [TaxId:1377]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44467 (Start-373)
      • engineered mutation (101)
      • engineered mutation (162)
      • engineered mutation (214)
      • engineered mutation (231)
      • engineered mutation (254)
    Domains in SCOPe 2.07: d5ebue_
  • Chain 'F':
    Compound: L-lactate oxidase
    Species: Aerococcus viridans [TaxId:1377]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44467 (Start-373)
      • engineered mutation (101)
      • engineered mutation (162)
      • engineered mutation (214)
      • engineered mutation (231)
      • engineered mutation (254)
    Domains in SCOPe 2.07: d5ebuf_
  • Chain 'G':
    Compound: L-lactate oxidase
    Species: Aerococcus viridans [TaxId:1377]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44467 (Start-373)
      • engineered mutation (101)
      • engineered mutation (162)
      • engineered mutation (214)
      • engineered mutation (231)
      • engineered mutation (254)
    Domains in SCOPe 2.07: d5ebug_
  • Chain 'H':
    Compound: L-lactate oxidase
    Species: Aerococcus viridans [TaxId:1377]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44467 (Start-373)
      • engineered mutation (101)
      • engineered mutation (162)
      • engineered mutation (231)
      • engineered mutation (254)
    Domains in SCOPe 2.07: d5ebuh_
  • Heterogens: FMN, PYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ebuA (A:)
    mnnndieynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkh
    kllyprlaqdveapdtsteilghkikapfimapiaahglahatkeagtaravsefgtims
    isaysgatfeeiseglnggprwfqiymakddqqnrdildeakgdgataiiltadstvsgn
    rdrdvknkfvypfgmpivqrylrgtaegmslnnifgaskqkisprdieeiaahsglpvfv
    kgiqhpedadmaikagasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvr
    rgehvakalasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedl
    kgldlfdnpygyey
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ebuA (A:)
    ynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkhkllyprl
    aqdveapdtsteilghkikapfimapiaahglahatkeagtaravsefgtimsisaysga
    tfeeiseglnggprwfqiymakddqqnrdildeakgdgataiiltadstvsgnrdrdvkn
    kfvypfgmpivqrylrgtaegmslnnifgaskqkisprdieeiaahsglpvfvkgiqhpe
    dadmaikagasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvrrgehvak
    alasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedlkgldlfd
    npygyey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ebuB (B:)
    mnnndieynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkh
    kllyprlaqdveapdtsteilghkikapfimapiaahglahatkeagtaravsefgtims
    isaysgatfeeiseglnggprwfqiymakddqqnrdildeakgdgataiiltadstvsgn
    rdrdvknkfvypfgmpivqrylrgtaegmslnnifgaskqkisprdieeiaahsglpvfv
    kgiqhpedadmaikagasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvr
    rgehvakalasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedl
    kgldlfdnpygyey
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ebuB (B:)
    ynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkhkllyprl
    aqdveapdtsteilghkikapfimapiaahglahatkeagtaravsefgtimsisaysga
    tfeeiseglnggprwfqiymakddqqnrdildeakgdgataiiltadstvsgnrdrdvkn
    kfvypfgmpivqrylrgtaegmslnnifgaskqkisprdieeiaahsglpvfvkgiqhpe
    dadmaikagasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvrrgehvak
    alasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedlkgldlfd
    npygyey
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ebuC (C:)
    mnnndieynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkh
    kllyprlaqdveapdtsteilghkikapfimapiaahglahatkeagtaravsefgtims
    isaysgatfeeiseglnggprwfqiymakddqqnrdildeakgdgataiiltadstvsgn
    rdrdvknkfvypfgmpivqrylrgtaegmslnnifgaskqkisprdieeiaahsglpvfv
    kgiqhpedadmaikagasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvr
    rgehvakalasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedl
    kgldlfdnpygyey
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ebuC (C:)
    ynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkhkllyprl
    aqdveapdtsteilghkikapfimapiaahglahatkeagtaravsefgtimsisaysga
    tfeeiseglnggprwfqiymakddqqnrdildeakgdgataiiltadstvsgnrdrdvkn
    kfvypfgmpivqrylrgtaegmslnnifgaskqkisprdieeiaahsglpvfvkgiqhpe
    dadmaikagasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvrrgehvak
    alasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedlkgldlfd
    npygyey
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ebuD (D:)
    mnnndieynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkh
    kllyprlaqdveapdtsteilghkikapfimapiaahglahatkeagtaravsefgtims
    isaysgatfeeiseglnggprwfqiymakddqqnrdildeakgdgataiiltadstvsgn
    rdrdvknkfvypfgmpivqrylrgtaegmslnnifgaskqkisprdieeiaahsglpvfv
    kgiqhpedadmaikagasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvr
    rgehvakalasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedl
    kgldlfdnpygyey
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ebuD (D:)
    ieynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkhkllyp
    rlaqdveapdtsteilghkikapfimapiaahglahatkeagtaravsefgtimsisays
    gatfeeiseglnggprwfqiymakddqqnrdildeakgdgataiiltadstvsgnrdrdv
    knkfvypfgmpivqgaskqkisprdieeiaahsglpvfvkgiqhpedadmaikagasgiw
    vsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvrrgehvakalasgadvvalgrp
    vlfglalggwqgaysvldyfqkdltrvmqltgsqnvedlkgldlfdnpygyey
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5ebuE (E:)
    mnnndieynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkh
    kllyprlaqdveapdtsteilghkikapfimapiaahglahatkeagtaravsefgtims
    isaysgatfeeiseglnggprwfqiymakddqqnrdildeakgdgataiiltadstvsgn
    rdrdvknkfvypfgmpivqrylrgtaegmslnnifgaskqkisprdieeiaahsglpvfv
    kgiqhpedadmaikagasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvr
    rgehvakalasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedl
    kgldlfdnpygyey
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ebuE (E:)
    ynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkhkllyprl
    aqdveapdtsteilghkikapfimapiaahglahatkeagtaravsefgtimsisaysga
    tfeeiseglnggprwfqiymakddqqnrdildeakgdgataiiltadstvsgnrdrdvkn
    kfvypfgmpivqrylrgtaegmslnnifgaskqkisprdieeiaahsglpvfvkgiqhpe
    dadmaikagasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvrrgehvak
    alasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedlkgldlfd
    npygyey
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5ebuF (F:)
    mnnndieynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkh
    kllyprlaqdveapdtsteilghkikapfimapiaahglahatkeagtaravsefgtims
    isaysgatfeeiseglnggprwfqiymakddqqnrdildeakgdgataiiltadstvsgn
    rdrdvknkfvypfgmpivqrylrgtaegmslnnifgaskqkisprdieeiaahsglpvfv
    kgiqhpedadmaikagasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvr
    rgehvakalasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedl
    kgldlfdnpygyey
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ebuF (F:)
    ynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkhkllyprl
    aqdveapdtsteilghkikapfimapiaahglahatkeagtaravsefgtimsisaysga
    tfeeiseglnggprwfqiymakddqqnrdildeakgdgataiiltadstvsgnrdrdvkn
    kfvypfgmpivqrylrgtaegmslnnifgaskqkisprdieeiaahsglpvfvkgiqhpe
    dadmaikagasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvrrgehvak
    alasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedlkgldlfd
    npygyey
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5ebuG (G:)
    mnnndieynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkh
    kllyprlaqdveapdtsteilghkikapfimapiaahglahatkeagtaravsefgtims
    isaysgatfeeiseglnggprwfqiymakddqqnrdildeakgdgataiiltadstvsgn
    rdrdvknkfvypfgmpivqrylrgtaegmslnnifgaskqkisprdieeiaahsglpvfv
    kgiqhpedadmaikagasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvr
    rgehvakalasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedl
    kgldlfdnpygyey
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ebuG (G:)
    ynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkhkllyprl
    aqdveapdtsteilghkikapfimapiaahglahatkeagtaravsefgtimsisaysga
    tfeeiseglnggprwfqiymakddqqnrdildeakgdgataiiltadstvsgnrdrdvkn
    kfvypfgmpivqrylrgtaegmslnnifgaskqkisprdieeiaahsglpvfvkgiqhpe
    dadmaikagasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvrrgehvak
    alasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedlkgldlfd
    npygyey
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5ebuH (H:)
    mnnndieynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkh
    kllyprlaqdveapdtsteilghkikapfimapiaahglahatkeagtaravsefgtims
    isaysgatfeeiseglnggprwfqiymakddqqnrdildeakgdgataiiltadstvsgn
    rdrdvknkfvypfgmpivqrylrgtaegmslnnifgaskqkisprdieeiaahsglpvfv
    kgiqhpedadmaikagasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvr
    rgehvakalasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedl
    kgldlfdnpygyey
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ebuH (H:)
    ynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkhkllyprl
    aqdveapdtsteilghkikapfimapiaahglahatkeagtaravsefgtimsisaysga
    tfeeiseglnggprwfqiymakddqqnrdildeakgdgataiiltadstvsgnrdrdvkn
    kfvypfgmpivqaskqkisprdieeiaahsglpvfvkgiqhpedadmaikagasgiwvsn
    hgarqlyeapgsfdtlpaiaervnkrvpivfdsgvrrgehvakalasgadvvalgrpvlf
    glalggwqgaysvldyfqkdltrvmqltgsqnvedlkgldlfdnpygyey