PDB entry 5ebm

View 5ebm on RCSB PDB site
Description: KcsA T75G mutant in the nonconductive state
Class: membrane protein
Keywords: alpha-helical, Membrane protein, Fab, Channel
Deposited on 2015-10-19, released 2016-04-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-04-20, with a file datestamp of 2016-04-15.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody fab fragment light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5EBM (0-217)
  • Chain 'B':
    Compound: antibody fab fragment light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5EBM (0-211)
    Domains in SCOPe 2.06: d5ebmb1, d5ebmb2
  • Chain 'C':
    Compound: pH-gated potassium channel KcsA
    Species: Streptomyces lividans [TaxId:1916]
    Gene: kcsA, skc1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334
      • engineered mutation (74)
    Domains in SCOPe 2.06: d5ebmc_
  • Heterogens: DGA, F09, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ebmB (B:)
    dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips
    rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ebmC (C:)
    mapmlsgllarlvklllgrhgsalhwraagaatvllvivllagsylavlaergapgaqli
    typralwwsvetatgvgygdlypvtlwgrlvavvvmvagitsfglvtaalatwfvgreqe
    rrghf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ebmC (C:)
    lhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetatgvgygdlyp
    vtlwgrlvavvvmvagitsfglvtaalatwfvgreqerrgh