PDB entry 5eb1

View 5eb1 on RCSB PDB site
Description: the YfiB-YfiR complex
Class: membrane protein/transcription
Keywords: OmpA/Pal-like outer-membrane lipoprotein, periplasmic repressor protein, complex, MEMBRANE PROTEIN-TRANSCRIPTION complex
Deposited on 2015-10-17, released 2016-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: YfiR
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: yfiR, PA1121
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: YfiB
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: yfiB, PA1119
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5eb1b_
  • Chain 'C':
    Compound: YfiR
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: yfiR, PA1121
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: YfiB
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: yfiB, PA1119
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5eb1d_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5eb1B (B:)
    glsaeqiavpqeqgfelrdegwefgmsskvlfgnnldrlnpdsrntltkiarallavdid
    kvrleghtdnygdegynqklserraesvaavfreagmpaanievrglgmskpvadnktra
    grsenrrvaiivpae
    

    Sequence, based on observed residues (ATOM records): (download)
    >5eb1B (B:)
    qeqgfelrdegwefgmsskvlfgnnldrlnpdsrntltkiarallavdidkvrleghtdn
    ygdegynqklserraesvaavfreagmpaanievrglgmskpvadnktragrsenrrvai
    ivpa
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5eb1D (D:)
    glsaeqiavpqeqgfelrdegwefgmsskvlfgnnldrlnpdsrntltkiarallavdid
    kvrleghtdnygdegynqklserraesvaavfreagmpaanievrglgmskpvadnktra
    grsenrrvaiivpae
    

    Sequence, based on observed residues (ATOM records): (download)
    >5eb1D (D:)
    qeqgfelrdegwefgmsskvlfgnnldrlnpdsrntltkiarallavdidkvrleghtdn
    ygdegynqklserraesvaavfreagmpaanievrglgmskpvadnktragrsenrrvai
    ivpa