PDB entry 5eav

View 5eav on RCSB PDB site
Description: Unliganded structure of the ornithine aminotransferase from Toxoplasma gondii
Class: transferase
Keywords: PLP, gabaculine, parasite, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, TRANSFERASE
Deposited on 2015-10-16, released 2015-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-11-18, with a file datestamp of 2015-11-13.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ornithine aminotransferase, mitochondrial, putative
    Species: Toxoplasma gondii ME49 [TaxId:508771]
    Gene: TGME49_069110
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5eava_
  • Chain 'B':
    Compound: Ornithine aminotransferase, mitochondrial, putative
    Species: Toxoplasma gondii ME49 [TaxId:508771]
    Gene: TGME49_069110
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5eavb_
  • Heterogens: SO4, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5eavA (A:)
    matksdgsasaaaeggarktnieayrdglklkteedffacdrqyvcqnyapvpvviskgk
    garvwdingneyydflagvsslsqghchprviaalcrqaerltltlrafgndvtgpacrf
    maemfgydrvllmntgaeagesalkiarkwayevkeippdsakvilcnnnywgrtitacs
    ssttfdcynnfgpftpgfelidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgyl
    krahelcrsknvllivdeiqtglcrtgrllaadhdevhpdilllgkslsagvvpisavmg
    radvmdvlkpgthgstfggnplacavavealtvlkdekladraerlgaqfrdclrrelyg
    kvpwikeirgrgllnavevdsdaidpndvvmklkengilskptrgrvmrfipplvitdee
    hrdattriiksflaveeerkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5eavA (A:)
    rktnieayrdglklkteedffacdrqyvcqnyapvpvviskgkgarvwdingneyydfla
    gvsslsqghchprviaalcrqaerltltlrafgndvtgpacrfmaemfgydrvllmntga
    eagesalkiarkwayevkeippdsakvilcnnnywgrtitacsssttfdcynnfgpftpg
    felidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgylkrahelcrsknvllivd
    eiqtglcrtgrllaadhdevhpdilllgkslsagvvpisavmgradvmdvlkpgthgstf
    ggnplacavavealtvlkdekladraerlgaqfrdclrrelygkvpwikeirgrgllnav
    evdsdaidpndvvmklkengilskptrgrvmrfipplvitdeehrdattriiksflavee
    er
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5eavB (B:)
    matksdgsasaaaeggarktnieayrdglklkteedffacdrqyvcqnyapvpvviskgk
    garvwdingneyydflagvsslsqghchprviaalcrqaerltltlrafgndvtgpacrf
    maemfgydrvllmntgaeagesalkiarkwayevkeippdsakvilcnnnywgrtitacs
    ssttfdcynnfgpftpgfelidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgyl
    krahelcrsknvllivdeiqtglcrtgrllaadhdevhpdilllgkslsagvvpisavmg
    radvmdvlkpgthgstfggnplacavavealtvlkdekladraerlgaqfrdclrrelyg
    kvpwikeirgrgllnavevdsdaidpndvvmklkengilskptrgrvmrfipplvitdee
    hrdattriiksflaveeerkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5eavB (B:)
    tnieayrdglklkteedffacdrqyvcqnyapvpvviskgkgarvwdingneyydflagv
    sslsqghchprviaalcrqaerltltlrafgndvtgpacrfmaemfgydrvllmntgaea
    gesalkiarkwayevkeippdsakvilcnnnywgrtitacsssttfdcynnfgpftpgfe
    lidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgylkrahelcrsknvllivdei
    qtglcrtgrllaadhdevhpdilllgkslsagvvpisavmgradvmdvlkpgthgstfgg
    nplacavavealtvlkdekladraerlgaqfrdclrrelygkvpwikeirgrgllnavev
    dsdaidpndvvmklkengilskptrgrvmrfipplvitdeehrdattriiksflaveeer
    k