PDB entry 5e96

View 5e96 on RCSB PDB site
Description: Crystal structure of aminoglycoside 6'-acetyltransferase type Ii
Class: transferase
Keywords: GNAT, acetyltransferase, aminoglycoside resistance, TRANSFERASE
Deposited on 2015-10-14, released 2016-07-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-08, with a file datestamp of 2020-01-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminoglycoside 6'-acetyltransferase
    Species: Enterococcus faecium [TaxId:1352]
    Gene: aac(6 )-II
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5e96a_
  • Heterogens: PO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5e96A (A:)
    miisefdrnnpvlkdqlsdllrltwpeeygdssaeeveemmnperiavaavdqdelvgfi
    gaipqygitgwelhplvvessrrknqigtrlvnylekevasrggitiylgtddldhgttl
    sqtdlyehtfdkvasiqnlrehpyefyeklgykivgvlpnangwdkpdiwmaktiiprpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e96A (A:)
    miisefdrnnpvlkdqlsdllrltwpeeygdssaeeveemmnperiavaavdqdelvgfi
    gaipqygitgwelhplvvessrrknqigtrlvnylekevasrggitiylgtddldhehpy
    efyeklgykivgvlpnangwdkpdiwmaktiiprp