PDB entry 5e8x

View 5e8x on RCSB PDB site
Description: tgf-beta receptor type 1 kinase domain (t204d,i211v,y249f,s280t, y282f,s287n,a350c,l352f) in complex with staurosporine
Class: transferase/transferase inhibitor
Keywords: alk5, kinase domain, transferase-transferase inhibitor complex
Deposited on 2015-10-14, released 2016-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-05-11, with a file datestamp of 2016-05-06.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TGF-beta receptor type-1
    Species: Homo sapiens [TaxId:9606]
    Gene: TGFBR1, ALK5, SKR4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36897 (3-306)
      • engineered mutation (7)
      • engineered mutation (14)
      • engineered mutation (52)
      • engineered mutation (83)
      • engineered mutation (85)
      • engineered mutation (90)
      • engineered mutation (153)
      • engineered mutation (155)
    Domains in SCOPe 2.07: d5e8xa_
  • Heterogens: STU, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5e8xA (A:)
    ghmtiardivlqesvgkgrfgevwrgkwrgeevavkifssreerswfreaeifqtvmlrh
    enilgfiaadnkdngtwtqlwlvtdfhehgnlfdylnrytvtvegmiklalstasglahl
    hmeivgtqgkpaiahrdlksknilvkkngtccicdfglavrhdsatdtidiapnhrvgtk
    rymapevlddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdp
    sveemrkvvceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqls
    qqegikm
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e8xA (A:)
    tiardivlqesvgkgrfgevwrgkwrgeevavkifssreerswfreaeifqtvmlrheni
    lgfiaadnkdngtwtqlwlvtdfhehgnlfdylnrytvtvegmiklalstasglahlhme
    ivgtqgkpaiahrdlksknilvkkngtccicdfglavrhdsatdtidiapnhrvgtkrym
    apevlddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdpsve
    emrkvvceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqlsqqe
    gikm