PDB entry 5e8l

View 5e8l on RCSB PDB site
Description: Crystal structure of geranylgeranyl pyrophosphate synthase 11 from Arabidopsis thaliana
Class: transferase
Keywords: AtPPPS2, TRANSFERASE
Deposited on 2015-10-14, released 2015-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-11-11, with a file datestamp of 2015-11-06.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heterodimeric geranylgeranyl pyrophosphate synthase large subunit 1, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: GGPPS1, GGPPS11, GGPS1, At4g36810, C7A10.550
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e8la_
  • Chain 'B':
    Compound: Heterodimeric geranylgeranyl pyrophosphate synthase large subunit 1, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: GGPPS1, GGPPS11, GGPS1, At4g36810, C7A10.550
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e8lb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5e8lA (A:)
    mssfdfmsyiitkaelvnkaldsavplreplkiheamrysllaggkrvrpvlciaacelv
    ggeestampaacavemihtmslihddlpcmdnddlrrgkptnhkvfgedvavlagdalls
    fafehlasatssdvvspvrvvravgelakaigteglvagqvvdissegldlndvglehle
    fihlhktaalleasavlgaivgggsddeierlrkfarcigllfqvvddildvtksskelg
    ktagkdliadkltypkimgleksrefaeklnreardqllgfdsdkvapllalanyiayrq
    nlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e8lA (A:)
    sfdfmsyiitkaelvnkaldsavplreplkiheamrysllaggkrvrpvlciaacelvgg
    eestampaacavemihtmslihddlpcmdnddlrrgkptnhkvfgedvavlagdallsfa
    fehlasatssdvvspvrvvravgelakaigteglvagqvvdisvglehlefihlhktaal
    leasavlgaivgggsddeierlrkfarcigllfqvvddildvtkliadkltypkimglek
    srefaeklnreardqllgfdsdkvapllalanyiayrq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5e8lB (B:)
    mssfdfmsyiitkaelvnkaldsavplreplkiheamrysllaggkrvrpvlciaacelv
    ggeestampaacavemihtmslihddlpcmdnddlrrgkptnhkvfgedvavlagdalls
    fafehlasatssdvvspvrvvravgelakaigteglvagqvvdissegldlndvglehle
    fihlhktaalleasavlgaivgggsddeierlrkfarcigllfqvvddildvtksskelg
    ktagkdliadkltypkimgleksrefaeklnreardqllgfdsdkvapllalanyiayrq
    nlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e8lB (B:)
    sfdfmsyiitkaelvnkaldsavplreplkiheamrysllaggkrvrpvlciaacelvgg
    eestampaacavemihtmslihddlpcmdnddlrrgkptnhkvfgedvavlagdallsfa
    fehlasatssdvvspvrvvravgelakaigteglvagqvvdissegldlndvglehlefi
    hlhktaalleasavlgaivgggsddeierlrkfarcigllfqvvddildvtkltypkimg
    leksrefaeklnreardqllgfdsdkvapllalanyiayrq