PDB entry 5e73

View 5e73 on RCSB PDB site
Description: Crystal Structure of BAZ2B bromodomain in complex with acetylindole compound UZH47
Class: transcription
Keywords: four helical bundle, transcription
Deposited on 2015-10-11, released 2015-10-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-05-03, with a file datestamp of 2017-04-28.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Bromodomain adjacent to zinc finger domain protein 2B
  Species: Homo sapiens [TaxId:9606]
  Gene: BAZ2B, KIAA1476
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UIF8 (2-115)
    • expression tag (0-1)
  Domains in SCOPe 2.08: d5e73a1, d5e73a2
• Heterogens: UO1, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5e73A (A:)
  smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
  eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfkv