PDB entry 5e6y

View 5e6y on RCSB PDB site
Description: Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin
Class: transferase
Keywords: branching enzyme, cyclodextrin, glycogen, starch, glucan, TRANSFERASE
Deposited on 2015-10-11, released 2015-12-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-16, with a file datestamp of 2015-12-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1,4-alpha-glucan branching enzyme GlgB
    Species: Escherichia coli O139:H28 (strain E24377A / ETEC) [TaxId:331111]
    Gene: glgB, EcE24377A_3911
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5e6ya1, d5e6ya2, d5e6ya3
  • Chain 'B':
    Compound: 1,4-alpha-glucan branching enzyme GlgB
    Species: Escherichia coli O139:H28 (strain E24377A / ETEC) [TaxId:331111]
    Gene: glgB, EcE24377A_3911
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5e6yb1, d5e6yb2, d5e6yb3
  • Chain 'C':
    Compound: 1,4-alpha-glucan branching enzyme GlgB
    Species: Escherichia coli O139:H28 (strain E24377A / ETEC) [TaxId:331111]
    Gene: glgB, EcE24377A_3911
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5e6yc1, d5e6yc2, d5e6yc3
  • Chain 'D':
    Compound: 1,4-alpha-glucan branching enzyme GlgB
    Species: Escherichia coli O139:H28 (strain E24377A / ETEC) [TaxId:331111]
    Gene: glgB, EcE24377A_3911
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5e6yd1, d5e6yd2, d5e6yd3
  • Heterogens: ACX, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5e6yA (A:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehsdpregyhqdwntliynygrrevsnflvgnalywierfgidalrvdavasmiyrdys
    rkegewipnefggrenleaieflrntnrilgeqvsgavtmaeestdfpgvsrpqdmgglg
    fwykwnlgwmhdtldymkldpvyrqyhhdkltfgilynytenfvlplshdevvhgkksil
    drmpgdawqkfanlrayygwmwafpgkkllfmgnefaqgrewnhdasldwhlleggdnwh
    hgvqrlvrdlnltyrhhkamheldfdpygfewlvvddkersvlifvrrdkegneiivasn
    ftpvprhdyrfginqpgkwreilntdsmhyhgsnagnggtvhsdeiashgrqhslsltlp
    platiwlvreae
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e6yA (A:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehstliynygrrevsnflvgnalywierfgidalrvdavasmiyrggrenleaieflrn
    tnrilgeqvsgavtmaeestdfpgvsrpqdmgglgfwykwnlgwmhdtldymkldpvyrq
    yhhdkltfgilynytenfvlplshdevvhgkksildrmpgdawqkfanlrayygwmwafp
    gkkllfmgnefaqgrewnhdasldwhlleggdnwhhgvqrlvrdlnltyrhhkamheldf
    dpygfewlvvddkersvlifvrrdkegneiivasnftpvprhdyrfginqpgkwreilnt
    dsmhyhgsnagnggtvhsdeiashgrqhslsltlpplatiwlvreae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5e6yB (B:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehsdpregyhqdwntliynygrrevsnflvgnalywierfgidalrvdavasmiyrdys
    rkegewipnefggrenleaieflrntnrilgeqvsgavtmaeestdfpgvsrpqdmgglg
    fwykwnlgwmhdtldymkldpvyrqyhhdkltfgilynytenfvlplshdevvhgkksil
    drmpgdawqkfanlrayygwmwafpgkkllfmgnefaqgrewnhdasldwhlleggdnwh
    hgvqrlvrdlnltyrhhkamheldfdpygfewlvvddkersvlifvrrdkegneiivasn
    ftpvprhdyrfginqpgkwreilntdsmhyhgsnagnggtvhsdeiashgrqhslsltlp
    platiwlvreae
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e6yB (B:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehstliynygrrevsnflvgnalywierfgidalrvdavasmiyrdyipnefggrenle
    aieflrntnrilgeqvsgavtmaeestdfpgvsrpqdmgglgfwykwnlgwmhdtldymk
    ldpvyrqyhhdkltfgilynytenfvlplshdevvhgkksildrmpgdawqkfanlrayy
    gwmwafpgkkllfmgnefaqgrewnhdasldwhlleggdnwhhgvqrlvrdlnltyrhhk
    amheldfdpygfewlvvddkersvlifvrrdkegneiivasnftpvprhdyrfginqpgk
    wreilntdsmhyhgsnagnggtvhsdeiashgrqhslsltlpplatiwlvreae
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5e6yC (C:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehsdpregyhqdwntliynygrrevsnflvgnalywierfgidalrvdavasmiyrdys
    rkegewipnefggrenleaieflrntnrilgeqvsgavtmaeestdfpgvsrpqdmgglg
    fwykwnlgwmhdtldymkldpvyrqyhhdkltfgilynytenfvlplshdevvhgkksil
    drmpgdawqkfanlrayygwmwafpgkkllfmgnefaqgrewnhdasldwhlleggdnwh
    hgvqrlvrdlnltyrhhkamheldfdpygfewlvvddkersvlifvrrdkegneiivasn
    ftpvprhdyrfginqpgkwreilntdsmhyhgsnagnggtvhsdeiashgrqhslsltlp
    platiwlvreae
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e6yC (C:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehsliynygrrevsnflvgnalywierfgidalrvdavasmiyrrenleaieflrntnr
    ilgeqvsgavtmaeestdfpgvsrpqdmgglgfwykwnlgwmhdtldymkldpvyrqyhh
    dkltfgilynytenfvlplshdevvhgkksildrmpgdawqkfanlrayygwmwafpgkk
    llfmgnefaqgrewnhdasldwhlleggdnwhhgvqrlvrdlnltyrhhkamheldfdpy
    gfewlvvddkersvlifvrrdkegneiivasnftpvprhdyrfginqpgkwreilntdsm
    hyhgsnagnggtvhsdeiashgrqhslsltlpplatiwlvreae
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5e6yD (D:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehsdpregyhqdwntliynygrrevsnflvgnalywierfgidalrvdavasmiyrdys
    rkegewipnefggrenleaieflrntnrilgeqvsgavtmaeestdfpgvsrpqdmgglg
    fwykwnlgwmhdtldymkldpvyrqyhhdkltfgilynytenfvlplshdevvhgkksil
    drmpgdawqkfanlrayygwmwafpgkkllfmgnefaqgrewnhdasldwhlleggdnwh
    hgvqrlvrdlnltyrhhkamheldfdpygfewlvvddkersvlifvrrdkegneiivasn
    ftpvprhdyrfginqpgkwreilntdsmhyhgsnagnggtvhsdeiashgrqhslsltlp
    platiwlvreae
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e6yD (D:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehsntliynygrrevsnflvgnalywierfgidalrvdavasmiyrdggrenleaiefl
    rntnrilgeqvsgavtmaeestdfpgvsrpqdmgglgfwykwnlgwmhdtldymkldpvy
    rqyhhdkltfgilynytenfvlplshdevvhgkksildrmpgdawqkfanlrayygwmwa
    fpgkkllfmgnefaqgrewnhdasldwhlleggdnwhhgvqrlvrdlnltyrhhkamhel
    dfdpygfewlvvddkersvlifvrrdkegneiivasnftpvprhdyrfginqpgkwreil
    ntdsmhyhgsnagnggtvhsdeiashgrqhslsltlpplatiwlvreae