PDB entry 5e5r

View 5e5r on RCSB PDB site
Description: Crystal structure of the complex between Carbonic anhydrase-like domain of PTPRG and Immunoglobulin domains 2-3 of CNTN3
Class: Hydrolase/Cell Adhesion
Keywords: Neural cell adhesion molecule, Receptor-type protein tyrosine phosphatase, Immunoglobulin domains, Carbonic anhydrase-like domain, Hydrolase-Cell Adhesion complex
Deposited on 2015-10-09, released 2016-08-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-08-31, with a file datestamp of 2016-08-24.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Receptor-type tyrosine-protein phosphatase gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPRG, PTPG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5e5ra_
  • Chain 'B':
    Compound: Contactin-3
    Species: Mus musculus [TaxId:10090]
    Gene: Cntn3, Pang, Pcs
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5e5rb1, d5e5rb2
  • Chain 'C':
    Compound: Receptor-type tyrosine-protein phosphatase gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPRG, PTPG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5e5rc_
  • Chain 'D':
    Compound: Contactin-3
    Species: Mus musculus [TaxId:10090]
    Gene: Cntn3, Pang, Pcs
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5e5rd1, d5e5rd2
  • Heterogens: MLI, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5e5rA (A:)
    gdpywaysgaygpehwvtssvscggrhqspidildqyarvgeeyqelqldgfdnessnkt
    wmkntgktvaillkddyfvsgaglpgrfkaekvefhwghsngsagsehsingrrfpvemq
    iffynpddfdsfqtaisenriigamaiffqvsprdnsaldpiihglkgvvhheketfldp
    fvlrdllpaslgsyyrytgslttppcseivewivfrrpvpisyhqleafysiftteqqdh
    vksveylrnnfrpqqrlhdrvvsks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e5rA (A:)
    gdpywaysgaygpehwvtssvscggrhqspidildqyarelqldgfdnessnktwmkntg
    ktvaillkddyfvsgaglpgrfkaekvefhwghsngsagsehsngrrfpvemqiffynpd
    dfdsfqtaisenriigamaiffqvsprdnsaldpiihglkgvvhheketfldpfvlrdll
    paslgsyyrytgslttppcseivewivfrrpvpisyhqleafysiftteqqdhvksveyl
    rnnfrpqqrlhdrvvsks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5e5rB (B:)
    fktrmrstvsvregqgvvllcgppphsgelsyawvfneypsfveedsrrfvsqetghlyi
    akvepsdvgnytcvvtstvtntrvlgsptplvlrsdgvmgeyepkievqfpetlpaakgs
    tvrlecfalgnpvpqinwrrsdgmpfpnkiklrkfngmleiqnfqqedtgsyeciaensr
    gknvargrltyya
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e5rB (B:)
    ktrmrstvsvregqgvvllcgppelsyawvfneypfveedsrrfvsqetghlyiakveps
    dvgnytcvvtstvtntrvlgsptplvlrsdgvmgeyepkievqfpetlpaakgstvrlec
    falgnpvpqinwrrsdgmpfpnkiklrkfngmleiqnfqqedtgsyeciaensrgknvar
    grltyya
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5e5rC (C:)
    gdpywaysgaygpehwvtssvscggrhqspidildqyarvgeeyqelqldgfdnessnkt
    wmkntgktvaillkddyfvsgaglpgrfkaekvefhwghsngsagsehsingrrfpvemq
    iffynpddfdsfqtaisenriigamaiffqvsprdnsaldpiihglkgvvhheketfldp
    fvlrdllpaslgsyyrytgslttppcseivewivfrrpvpisyhqleafysiftteqqdh
    vksveylrnnfrpqqrlhdrvvsks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e5rC (C:)
    dpywaysgaygpehwvtssvscggrhqspidildqyarvgeeyqelqldgfdnessnktw
    mkntgktvaillkddyfvsgaglpgrfkaekvefhwghsngsagsehsingrrfpvemqi
    ffynpddfdsfqtaisenriigamaiffqvsprdnsaldpiihglkgvvhheketfldpf
    vlrdllpaslgsyyrytgslttppcseivewivfrrpvpisyhqleafysiftteqqdhv
    ksveylrnnfrpqqrlhdrvvsks
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5e5rD (D:)
    fktrmrstvsvregqgvvllcgppphsgelsyawvfneypsfveedsrrfvsqetghlyi
    akvepsdvgnytcvvtstvtntrvlgsptplvlrsdgvmgeyepkievqfpetlpaakgs
    tvrlecfalgnpvpqinwrrsdgmpfpnkiklrkfngmleiqnfqqedtgsyeciaensr
    gknvargrltyya
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e5rD (D:)
    fktrmrstvsvregqgvvllcgpppsgelsyawvfneypsfveedsrrfvsqetghlyia
    kvepsdvgnytcvvtstvtntrvlgsptplvlrsdgvmgeyepkievqfpetlpaakgst
    vrlecfalgnpvpqinwrrsdgmpfpnkiklrkfngmleiqnfqqedtgsyeciaensrg
    knvargrltyya