PDB entry 5e5i

View 5e5i on RCSB PDB site
Description: Structure of the ornithine aminotransferase from Toxoplasma gondii in complex with inactivator
Class: transferase
Keywords: inhibitor, complex, parasite, PYRIDOXAL 5'-PHOSPHATE, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, TRANSFERASE
Deposited on 2015-10-08, released 2016-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-19, with a file datestamp of 2016-10-14.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ornithine aminotransferase, mitochondrial
    Species: Toxoplasma gondii [TaxId:5811]
    Gene: TGME49_269110
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e5ia_
  • Chain 'B':
    Compound: Ornithine aminotransferase, mitochondrial
    Species: Toxoplasma gondii [TaxId:5811]
    Gene: TGME49_269110
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e5ib_
  • Heterogens: 5NJ, SO4, PEG, 5JV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5e5iA (A:)
    matksdgsasaaaeggarktnieayrdglklkteedffacdrqyvcqnyapvpvviskgk
    garvwdingneyydflagvsslsqghchprviaalcrqaerltltlrafgndvtgpacrf
    maemfgydrvllmntgaeagesalkiarkwayevkeippdsakvilcnnnywgrtitacs
    ssttfdcynnfgpftpgfelidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgyl
    krahelcrsknvllivdeiqtglcrtgrllaadhdevhpdilllgkslsagvvpisavmg
    radvmdvlkpgthgstfggnplacavavealtvlkdekladraerlgaqfrdclrrelyg
    kvpwikeirgrgllnavevdsdaidpndvvmklkengilskptrgrvmrfipplvitdee
    hrdattriiksflaveeerkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e5iA (A:)
    ktnieayrdglklkteedffacdrqyvcqnyapvpvviskgkgarvwdingneyydflag
    vsslsqghchprviaalcrqaerltltlrafgndvtgpacrfmaemfgydrvllmntgae
    agesalkiarkwayevkeippdsakvilcnnnywgrtitacsssttfdcynnfgpftpgf
    elidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgylkrahelcrsknvllivde
    iqtglcrtgrllaadhdevhpdilllgkslsagvvpisavmgradvmdvlkpgthgstfg
    gnplacavavealtvlkdekladraerlgaqfrdclrrelygkvpwikeirgrgllnave
    vdsdaidpndvvmklkengilskptrgrvmrfipplvitdeehrdattriiksflaveee
    r
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5e5iB (B:)
    matksdgsasaaaeggarktnieayrdglklkteedffacdrqyvcqnyapvpvviskgk
    garvwdingneyydflagvsslsqghchprviaalcrqaerltltlrafgndvtgpacrf
    maemfgydrvllmntgaeagesalkiarkwayevkeippdsakvilcnnnywgrtitacs
    ssttfdcynnfgpftpgfelidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgyl
    krahelcrsknvllivdeiqtglcrtgrllaadhdevhpdilllgkslsagvvpisavmg
    radvmdvlkpgthgstfggnplacavavealtvlkdekladraerlgaqfrdclrrelyg
    kvpwikeirgrgllnavevdsdaidpndvvmklkengilskptrgrvmrfipplvitdee
    hrdattriiksflaveeerkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e5iB (B:)
    tnieayrdglklkteedffacdrqyvcqnyapvpvviskgkgarvwdingneyydflagv
    sslsqghchprviaalcrqaerltltlrafgndvtgpacrfmaemfgydrvllmntgaea
    gesalkiarkwayevkeippdsakvilcnnnywgrtitacsssttfdcynnfgpftpgfe
    lidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgylkrahelcrsknvllivdei
    qtglcrtgrllaadhdevhpdilllgkslsagvvpisavmgradvmdvlkpgthgstfgg
    nplacavavealtvlkdekladraerlgaqfrdclrrelygkvpwikeirgrgllnavev
    dsdaidpndvvmklkengilskptrgrvmrfipplvitdeehrdattriiksflaveeer
    k