PDB entry 5e4x

View 5e4x on RCSB PDB site
Description: Crystal structure of cpSRP43 chromodomain 3
Class: transport protein
Keywords: Signal recognition particle, cpSRP43, chromodomain 3, chloroplast, transport protein
Deposited on 2015-10-07, released 2015-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-02, with a file datestamp of 2015-11-27.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Signal recognition particle 43 kDa protein, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: CAO, CPSRP43, At2g47450, T30B22.25
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e4xa_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5e4xA (A:)
yavaesvigkrvgddgktieylvkwtdmsdatwepqdnvdstlvllyqqq