PDB entry 5e4g

View 5e4g on RCSB PDB site
Description: Crystal structure of human growth differentiation factor 11 (GDF-11)
Class: hormone
Keywords: Bone morphogenetic protein 11, BMP-11, GDF 11, HORMONE, growth factor
Deposited on 2015-10-06, released 2016-03-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-03-09, with a file datestamp of 2016-03-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Growth/differentiation factor 11
    Species: Homo sapiens [TaxId:9606]
    Gene: GDF11, BMP11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5e4ga_
  • Heterogens: PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5e4gA (A:)
nlgldcdehssesrccrypltvdfeafgwdwiiapkrykanycsgqceymfmqkyphthl
vqqanprgsagpcctptkmspinmlyfndkqqiiygkipgmvvdrcgcs

    Sequence, based on observed residues (ATOM records): (download) 
    >5e4gA (A:)
lgldcdehssesrccrypltvdfeafgwdwiiapkrykanycsgqceymfmqkyphthlv
qqanprgsagpcctptkmspinmlyfndkqqiiygkipgmvvdrcgcs