PDB entry 5e3k

View 5e3k on RCSB PDB site
Description: Crystal structure of the ornithine aminotransferase from Toxoplasma gondii ME49 in a complex with (S)-4-amino-5-fluoropentanoic acid
Class: transferase
Keywords: inhibitor, complex, parasite, PYRIDOXAL 5'-PHOSPHATE, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, TRANSFERASE
Deposited on 2015-10-02, released 2016-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-26, with a file datestamp of 2016-10-21.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aminotransferase
    Species: Toxoplasma gondii [TaxId:508771]
    Gene: TGME49_269110
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e3ka_
  • Chain 'B':
    Compound: aminotransferase
    Species: Toxoplasma gondii [TaxId:508771]
    Gene: TGME49_269110
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e3kb_
  • Heterogens: 5JV, SO4, PEG, CO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5e3kA (A:)
    matksdgsasaaaeggarktnieayrdglklkteedffacdrqyvcqnyapvpvviskgk
    garvwdingneyydflagvsslsqghchprviaalcrqaerltltlrafgndvtgpacrf
    maemfgydrvllmntgaeagesalkiarkwayevkeippdsakvilcnnnywgrtitacs
    ssttfdcynnfgpftpgfelidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgyl
    krahelcrsknvllivdeiqtglcrtgrllaadhdevhpdilllgkslsagvvpisavmg
    radvmdvlkpgthgstfggnplacavavealtvlkdekladraerlgaqfrdclrrelyg
    kvpwikeirgrgllnavevdsdaidpndvvmklkengilskptrgrvmrfipplvitdee
    hrdattriiksflaveeerkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e3kA (A:)
    rktnieayrdglklkteedffacdrqyvcqnyapvpvviskgkgarvwdingneyydfla
    gvsslsqghchprviaalcrqaerltltlrafgndvtgpacrfmaemfgydrvllmntga
    eagesalkiarkwayevkeippdsakvilcnnnywgrtitacsssttfdcynnfgpftpg
    felidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgylkrahelcrsknvllivd
    eiqtglcrtgrllaadhdevhpdilllgkslsagvvpisavmgradvmdvlkpgthgstf
    ggnplacavavealtvlkdekladraerlgaqfrdclrrelygkvpwikeirgrgllnav
    evdsdaidpndvvmklkengilskptrgrvmrfipplvitdeehrdattriiksflavee
    er
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5e3kB (B:)
    matksdgsasaaaeggarktnieayrdglklkteedffacdrqyvcqnyapvpvviskgk
    garvwdingneyydflagvsslsqghchprviaalcrqaerltltlrafgndvtgpacrf
    maemfgydrvllmntgaeagesalkiarkwayevkeippdsakvilcnnnywgrtitacs
    ssttfdcynnfgpftpgfelidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgyl
    krahelcrsknvllivdeiqtglcrtgrllaadhdevhpdilllgkslsagvvpisavmg
    radvmdvlkpgthgstfggnplacavavealtvlkdekladraerlgaqfrdclrrelyg
    kvpwikeirgrgllnavevdsdaidpndvvmklkengilskptrgrvmrfipplvitdee
    hrdattriiksflaveeerkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e3kB (B:)
    arktnieayrdglklkteedffacdrqyvcqnyapvpvviskgkgarvwdingneyydfl
    agvsslsqghchprviaalcrqaerltltlrafgndvtgpacrfmaemfgydrvllmntg
    aeagesalkiarkwayevkeippdsakvilcnnnywgrtitacsssttfdcynnfgpftp
    gfelidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgylkrahelcrsknvlliv
    deiqtglcrtgrllaadhdevhpdilllgkslsagvvpisavmgradvmdvlkpgthgst
    fggnplacavavealtvlkdekladraerlgaqfrdclrrelygkvpwikeirgrgllna
    vevdsdaidpndvvmklkengilskptrgrvmrfipplvitdeehrdattriiksflave
    eerk