PDB entry 5e3g
View 5e3g on RCSB PDB site
Description: Crystal structure of the human BRPF1 bromodomain in complex with SEED8
Class: DNA binding protein
Keywords: Bromodomain and PHD finger-containing protein 1(BRPF1), monocytic leukemia zinc-finger (MOZ), Inhibitor, transcription, DNA BINDING PROTEIN
Deposited on
2015-10-02, released
2016-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated
2016-06-22, with a file datestamp of
2016-06-17.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Peregrin
Species: Homo sapiens [TaxId:9606]
Gene: BRPF1, BR140
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d5e3ga_ - Heterogens: 5JQ, NO3, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>5e3gA (A:)
smemqltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnlea
yrylnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekmg
Sequence, based on observed residues (ATOM records): (download)
>5e3gA (A:)
mqltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnleayry
lnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekm