PDB entry 5e3g

View 5e3g on RCSB PDB site
Description: Crystal structure of the human BRPF1 bromodomain in complex with SEED8
Class: DNA binding protein
Keywords: Bromodomain and PHD finger-containing protein 1(BRPF1), monocytic leukemia zinc-finger (MOZ), Inhibitor, transcription, DNA BINDING PROTEIN
Deposited on 2015-10-02, released 2016-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-06-22, with a file datestamp of 2016-06-17.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peregrin
    Species: Homo sapiens [TaxId:9606]
    Gene: BRPF1, BR140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5e3ga_
  • Heterogens: 5JQ, NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5e3gA (A:)
    smemqltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnlea
    yrylnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e3gA (A:)
    mqltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnleayry
    lnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekm