PDB entry 5e34

View 5e34 on RCSB PDB site
Description: Crystal structure of H5 hemagglutinin mutant (N224K, Q226L, N158D and L133a deletion) from the influenza virus A/chicken/Vietnam/NCVD-093/2008 (H5N1) with LSTa
Class: viral protein
Keywords: H5N1 influenza virus, hemagglutinin, receptor binding specificity, transmission, glycan complex, VIRAL PROTEIN
Deposited on 2015-10-01, released 2015-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-09, with a file datestamp of 2015-12-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/chicken/Vietnam/NCVD-093/2008(H5N1)) [TaxId:581024]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot C4P282 (4-End)
      • expression tag (1-3)
      • engineered mutation (156)
      • engineered mutation (222)
      • engineered mutation (224)
    Domains in SCOPe 2.07: d5e34a1, d5e34a2
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:581024]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e34b_
  • Heterogens: NAG, SIA, GAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5e34A (A:)
    adpgdqicvgyhannsteqvdtimeknitvthaqdilekthngklcnlngvkplilkdcs
    vagwllgnpmcdeflnvsewsyivekaspanglcypgdfndyeelkhllsrinhfekiki
    ipksywsnhetsgvssacsylenpsffrnvvwltkkdntyppikvnytnanqkdllvlwg
    ihhpnneaeqkmiyqnlntyvsvgtstlnqrlvpkiatrskvkglsgrmdffwtilkpnd
    tinfdsngnfiapeyaykivkkgdsaimkseleygncntkcqtpigainssmpfhnihpl
    tigecpkyvksnrlvlatglrnapqiegrrrkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e34A (A:)
    dpgdqicvgyhannsteqvdtimeknitvthaqdilekthngklcnlngvkplilkdcsv
    agwllgnpmcdeflnvsewsyivekaspanglcypgdfndyeelkhllsrinhfekikii
    pksywsnhetsgvssacsylenpsffrnvvwltkkdntyppikvnytnanqkdllvlwgi
    hhpnneaeqkmiyqnlntyvsvgtstlnqrlvpkiatrskvkglsgrmdffwtilkpndt
    infdsngnfiapeyaykivkkgdsaimkseleygncntkcqtpigainssmpfhnihplt
    igecpkyvksnrlvlatglrnap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5e34B (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgitnkinsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlye
    kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydypqyseearlnreeisgrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e34B (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgitnkinsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlye
    kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydypqyseearlnreeisg