PDB entry 5e2y

View 5e2y on RCSB PDB site
Description: Crystal structure of H5 hemagglutinin Q226L mutant from the influenza virus A/duck/Egypt/10185SS/2010 (H5N1)
Class: viral protein
Keywords: H5N1 influenza virus, hemagglutinin, receptor binding specificity, transmission, glycan complex, VIRAL PROTEIN
Deposited on 2015-10-01, released 2015-12-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-01-13, with a file datestamp of 2016-01-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/duck/Egypt/10185SS/2010(H5N1)) [TaxId:1092915]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot G8IPF0 (4-End)
      • expression tag (1-3)
      • engineered mutation (224)
    Domains in SCOPe 2.06: d5e2ya1, d5e2ya2
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1092915]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot G8IPF0 (1-174)
      • expression tag (0)
    Domains in SCOPe 2.06: d5e2yb1, d5e2yb2
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/duck/Egypt/10185SS/2010(H5N1)) [TaxId:1092915]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot G8IPF0 (4-End)
      • expression tag (1-3)
      • engineered mutation (224)
    Domains in SCOPe 2.06: d5e2yc1, d5e2yc2
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1092915]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot G8IPF0 (1-174)
      • expression tag (0)
    Domains in SCOPe 2.06: d5e2yd1, d5e2yd2
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/duck/Egypt/10185SS/2010(H5N1)) [TaxId:1092915]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot G8IPF0 (4-End)
      • expression tag (1-3)
      • engineered mutation (224)
    Domains in SCOPe 2.06: d5e2ye1, d5e2ye2
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1092915]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot G8IPF0 (1-174)
      • expression tag (0)
    Domains in SCOPe 2.06: d5e2yf1, d5e2yf2
  • Heterogens: NAG, FUL, FUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5e2yA (A:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekthngklcnldgvkplilrdcs
    vagwllgnpmcdeflnvpewsyivekinpandlcypgnfndyeelkhllsrinhfekiqi
    tpknswsdheasgvssacpyqgrssffrnvvwltkkdnayptikrsynntnqedllvlwg
    ihhpndateqtrlyqnpttyisvgtstlnqklvpkiatrskvkglsgrmeffwtilksnd
    ainfesngnfiapenaykivkkgdstimkseleygdcntkcqtpigainssmpfhnihpl
    tigecpkyvksnrlvlatglrnspqgerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e2yA (A:)
    dpgdqicigyhannsteqvdtimeknvtvthaqdilekthngklcnldgvkplilrdcsv
    agwllgnpmcdeflnvpewsyivekinpandlcypgnfndyeelkhllsrinhfekiqit
    pknswsdheasgvssacpyqgrssffrnvvwltkkdnayptikrsynntnqedllvlwgi
    hhpndateqtrlyqnpttyisvgtstlnqklvpkiatrskvkglsgrmeffwtilksnda
    infesngnfiapenaykivkkgdstimkseleygdcntkcqtpigainssmpfhnihplt
    igecpkyvksnrlvlatglrnsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5e2yB (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhrcdnecmesvrngtydypqyseearlkreeisgrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e2yB (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhrcdnecmesvrngtydypqyseearlkreeisg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5e2yC (C:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekthngklcnldgvkplilrdcs
    vagwllgnpmcdeflnvpewsyivekinpandlcypgnfndyeelkhllsrinhfekiqi
    tpknswsdheasgvssacpyqgrssffrnvvwltkkdnayptikrsynntnqedllvlwg
    ihhpndateqtrlyqnpttyisvgtstlnqklvpkiatrskvkglsgrmeffwtilksnd
    ainfesngnfiapenaykivkkgdstimkseleygdcntkcqtpigainssmpfhnihpl
    tigecpkyvksnrlvlatglrnspqgerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e2yC (C:)
    dpgdqicigyhannsteqvdtimeknvtvthaqdilekthngklcnldgvkplilrdcsv
    agwllgnpmcdeflnvpewsyivekinpandlcypgnfndyeelkhllsrinhfekiqit
    pknswsdheasgvssacpyqgrssffrnvvwltkkdnayptikrsynntnqedllvlwgi
    hhpndateqtrlyqnpttyisvgtstlnqklvpkiatrskvkglsgrmeffwtilksnda
    infesngnfiapenaykivkkgdstimkseleygdcntkcqtpigainssmpfhnihplt
    igecpkyvksnrlvlatglrnsp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5e2yD (D:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhrcdnecmesvrngtydypqyseearlkreeisgrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e2yD (D:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhrcdnecmesvrngtydypqyseearlkreeisg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5e2yE (E:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekthngklcnldgvkplilrdcs
    vagwllgnpmcdeflnvpewsyivekinpandlcypgnfndyeelkhllsrinhfekiqi
    tpknswsdheasgvssacpyqgrssffrnvvwltkkdnayptikrsynntnqedllvlwg
    ihhpndateqtrlyqnpttyisvgtstlnqklvpkiatrskvkglsgrmeffwtilksnd
    ainfesngnfiapenaykivkkgdstimkseleygdcntkcqtpigainssmpfhnihpl
    tigecpkyvksnrlvlatglrnspqgerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e2yE (E:)
    dpgdqicigyhannsteqvdtimeknvtvthaqdilekthngklcnldgvkplilrdcsv
    agwllgnpmcdeflnvpewsyivekinpandlcypgnfndyeelkhllsrinhfekiqit
    pknswsdheasgvssacpyqgrssffrnvvwltkkdnayptikrsynntnqedllvlwgi
    hhpndateqtrlyqnpttyisvgtstlnqklvpkiatrskvkglsgrmeffwtilksnda
    infesngnfiapenaykivkkgdstimkseleygdcntkcqtpigainssmpfhnihplt
    igecpkyvksnrlvlatglrnsp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5e2yF (F:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhrcdnecmesvrngtydypqyseearlkreeisgrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e2yF (F:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhrcdnecmesvrngtydypqyseearlkreeisg