PDB entry 5e21

View 5e21 on RCSB PDB site
Description: PDZ2 of LNX2 at 277K,single conformer model
Class: protein binding
Keywords: Room temperature, PROTEIN BINDING
Deposited on 2015-09-30, released 2016-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-01-11, with a file datestamp of 2017-01-06.
Experiment type: XRAY
Resolution: 1.01 Å
R-factor: N/A
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ligand of numb protein x 2
    Species: Homo sapiens [TaxId:9606]
    Gene: LNX2, PDZRN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8N448 (2-90)
      • expression tag (0-1)
      • engineered mutation (4)
      • see remark 999 (91-94)
    Domains in SCOPe 2.08: d5e21a1, d5e21a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5e21A (A:)
smeilqvalhkrdsgeqlgiklvrrtdepgvfildllegglaaqdgrlssndrvlaingh
dlkygtpelaaqiiqasgervnltiarpgkpeiel